KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p12670Help
Entry
SCATT_p12670      CDS       T02095                                 

Definition
(GenBank) Chain A, Acanthamoeba Castellanii Profilin Ib'
  KO
K05759  
profilin
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
Membrane trafficking [BR:scy04131]
 Others
  Actin-binding proteins
   Others
    SCATT_p12670
Cytoskeleton proteins [BR:scy04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     SCATT_p12670
Exosome [BR:scy04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCATT_p12670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pSCATT:1270072..1270455
Genome map
AA seq 127 aa AA seqDB search
MNTVWQQYVDRHLVGTRQMRHGAILGLNGSTWGASAGFAVRPDEGRSLALLLGERSIAGR
VFTVGGARYTAGRCDPHVVHGTNSDSGLVALQARGALVVGVYDGRDVPERAREAVEKLAR
RLLDDRG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggtgtggcagcagtacgtggaccggcatctggtgggcaccaggcagatgcgg
cacggggcgatcctggggctcaacgggagtacgtggggcgcgtcggccgggttcgccgtc
cggccggacgagggacgttcgctcgccctgctcctcggtgaacgctccatcgccggacgg
gtgttcaccgtgggcggcgcccggtacaccgccggccgctgcgacccgcacgtggtgcac
ggcaccaacagcgacagcggcctggtcgccctccaggcccgtggagcgctggtcgtcggc
gtctacgacggccgggacgtgcccgagcgcgccagggaggccgtcgagaaactggcccgg
cgcctcctcgacgaccggggctga

DBGET integrated database retrieval system