KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p12670Help
Entry
SCATT_p12670      CDS       T02095                                 

Definition
Chain A, Acanthamoeba Castellanii Profilin Ib'
Orthology
K05759  
profilin
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
Exosome [BR:scy04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCATT_p12670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCATT:1270072..1270455
Genome map
AA seq 127 aa AA seqDB search
MNTVWQQYVDRHLVGTRQMRHGAILGLNGSTWGASAGFAVRPDEGRSLALLLGERSIAGR
VFTVGGARYTAGRCDPHVVHGTNSDSGLVALQARGALVVGVYDGRDVPERAREAVEKLAR
RLLDDRG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggtgtggcagcagtacgtggaccggcatctggtgggcaccaggcagatgcgg
cacggggcgatcctggggctcaacgggagtacgtggggcgcgtcggccgggttcgccgtc
cggccggacgagggacgttcgctcgccctgctcctcggtgaacgctccatcgccggacgg
gtgttcaccgtgggcggcgcccggtacaccgccggccgctgcgacccgcacgtggtgcac
ggcaccaacagcgacagcggcctggtcgccctccaggcccgtggagcgctggtcgtcggc
gtctacgacggccgggacgtgcccgagcgcgccagggaggccgtcgagaaactggcccgg
cgcctcctcgacgaccggggctga

DBGET integrated database retrieval system