KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p16060Help
Entry
SCATT_p16060      CDS       T02095                                 

Definition
putative xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
Enzymes [BR:scy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SCATT_p16060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCATT:complement(1667324..1668796)
Genome map
AA seq 490 aa AA seqDB search
MPLGRTLIRLHHAWALAVALALVLATGALAATTPAVAAGSTLKAAAESDGRYFGTALTDA
DLGVTGETTVAGTQFDMLTPGNEMKWDTTEPSNGSYNFGPGDQLVRFAQAHGMRVRGHNL
VWQSQLPAWVRNLPLNQVRSAMESHITTEATHYKGQVYAWDVVNEPFNADGSLVGDVFYQ
AMGSGYLADALRTAHAADPGAKLYINDYGIEGENAKSDALYRLAQSLLSQGVPLGGIGFE
SHFVLGQIPADMRANMERFANLGLDVAVTELDDRVQLPASGSALQQQSTDFGAVVRDCLA
VTRCVGVSQWGVDDAHSWIPGAFPGYGAATMYDGNDQPKPAYGAALSALGGSNPGGGGGT
TGELRAVGAGKCLDVPGGSTAAGTQVQIYGCWGGTNQLWTRTPSGQLTVYGGSGQLCLDA
QGQGAVPGTKVVTWPCNGQANQQWRFNADGTVTGVQSGLCLDVTGASTADGALAQLWTCT
GHTNQQWTLG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcggaaggaccctgatcagacttcaccacgcctgggccttagcggtcgccctg
gcgctggtcctcgcgaccggtgcactggccgcgacgacaccggccgtcgcggccggcagc
acgttgaaggcggcggcggagtcggacggccggtatttcggcaccgcgctgaccgacgcc
gacctcggcgtcaccggtgaaaccaccgtcgccgggacacagttcgacatgctgaccccc
ggcaacgagatgaagtgggacaccaccgagccgtccaacggctcgtacaacttcggtccg
ggcgaccagctcgtacggttcgcccaggcacacggcatgcgggtgcgcggtcacaacctg
gtctggcagagccagttgcccgcctgggtgaggaacttgccgctgaaccaggtgcgctcc
gccatggagtcgcacatcaccaccgaggccacccactacaaggggcaggtctacgcgtgg
gacgtggtcaacgagccgttcaacgccgacggctccctcgtcggggacgtgttctaccag
gcgatggggtccggttatctcgccgacgcgctgcgcaccgcgcacgccgccgacccgggc
gccaagctctacatcaacgactacggcatcgagggtgagaacgcgaagagcgacgccctc
taccgcctcgcgcagtcgctcctctcccagggcgtaccgctgggcggcatcgggttcgag
agccacttcgtcctcggccagatccccgccgacatgcgggccaacatggagcgcttcgcg
aacctgggcctggacgtggccgtcaccgaactggacgaccgcgtccagctccccgcctcc
ggctccgccctccaacagcagtccaccgacttcggcgccgtggtgcgcgactgcctggcc
gtcacccgctgcgtgggcgtgagccagtggggcgtggacgacgcgcactcctggatcccc
ggtgccttccccggctacggcgccgccaccatgtacgacggcaacgaccagcccaagccg
gcctacggcgcggcgctctccgcgctgggcggatcgaaccccggcggaggcggtggcacc
acgggtgagttgcgtgcggtgggtgcgggcaagtgccttgacgtgccgggtggttcgacc
gcggcaggtacccaggtgcagatctacggctgctggggcggtaccaaccagttgtggacc
cgtaccccgtccggccagttgaccgtgtacgggggcagtggccagttgtgcctggacgcc
caggggcagggcgccgtccctggtaccaaggtggtcacctggccctgcaacggccaggcc
aaccagcagtggcgcttcaacgccgacggcaccgtcaccggcgtccagtccggcctgtgc
ctcgacgtcaccggcgcctccaccgccgacggcgccctggcccagctgtggacgtgcacc
ggccacaccaaccagcaatggaccctcggctga

DBGET integrated database retrieval system