KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p17170Help
Entry
SCATT_p17170      CDS       T02095                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCATT_p17170
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SCATT_p17170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCATT:complement(1784530..1785447)
Genome map
AA seq 305 aa AA seqDB search
MDEYDLLVVGSANADLVIGVERRPAAGETVLGSDLAVHPGGKGANQAVAAARLGARTALL
ARVGDDAHGRLLLDAQRAAGVDPVGVLVGGAPTGVALITVDPSGDNSIVVSPGANGRLTP
EDVRAAAGLFQASRVVSAQLEVPLETVVEAVRHLAPGSRFVLNPSPPRPLPRELLEACDP
LIVNEHEAKVILAGADGSGADVGEDPQGWARALLALGPRSVVVTLGAEGALVAWPERVVR
VPSVTVDAVDTTGAGDAFTAALACRLGAGASLQEAARYAARVGAVAVTRHGAQESYPTAA
EVDAL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtacgacctgctggtcgtggggtcggccaacgccgacctggtgatcggcgtc
gagcggcggcccgcggccggcgagacggtgctcggttcggacctggccgtccaccccggc
ggcaagggcgccaaccaggcggtggccgccgcccggttgggggcccgtacggcactgctg
gcccgggtcggcgacgacgcacacggccggctgctgctcgacgcgcagcgcgcggccggg
gtggacccggtgggcgtgctggtgggcggggcgcccaccggggtggcgctgatcacggtg
gacccgtccggggacaacagcatcgtggtctcgccgggtgccaacggccggctcacgccc
gaggacgtgcgggcggcggccgggctcttccaggcatcccgggtggtctccgcgcagttg
gaggtcccgttggagacggtcgtggaggcggtacggcacctggctcccggcagccgtttc
gtgctcaacccctccccgccgcgtccgctgccgcgggaactgctggaggcctgcgacccg
ctgatcgtcaacgagcacgaggccaaggtgatcctcgccggggcggacgggagcggcgcg
gacgttggcgaggatccgcaagggtgggcgcgggcgctgctcgccctcggcccgcgctcg
gtggtcgtcaccctgggcgccgagggcgcgctggtggcgtggcccgagcgggtggtcagg
gtgccgtcggtgacggtggacgccgtggacaccacgggcgcgggcgacgcgttcaccgcg
gcgctggcctgccggctgggcgcgggagcgtccttgcaggaggcggcccgctacgcggcc
cgggtgggcgcggtggccgtcaccaggcacggcgcgcaggagtcctaccccacggcggcg
gaggtcgacgcgctgtga

DBGET integrated database retrieval system