KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0059Help
Entry
GGS_0059          CDS       T02269                                 

Gene name
adh2
Definition
bifunctional alcohol dehydrogenase/acetaldehyde dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GGS_0059 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GGS_0059 (adh2)
   00620 Pyruvate metabolism
    GGS_0059 (adh2)
   00650 Butanoate metabolism
    GGS_0059 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    GGS_0059 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    GGS_0059 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GGS_0059 (adh2)
   00626 Naphthalene degradation
    GGS_0059 (adh2)
Enzymes [BR:sda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GGS_0059 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GGS_0059 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56851..59493
Genome map
AA seq 880 aa AA seqDB search
MTEGHNTVETTSVSATIDTLVQKGLAALEEMRKLGQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWVET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIVDKEIYDDFVAEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKAATWIAEQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFIAIPTTSGTGSEVTPFAVISDKVNNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFETLEKSVKEADFESREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEAVESYAKAVYDLGCRVGIKMNFKDQGIDENEWKEHSRALA
YLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaggacataacactgttgaaacaacctctgtttctgcgacaattgatactctt
gttcaaaaaggtttagctgctcttgaagagatgcgtaagcttggccaagaacaagttgac
tatatcgtagcaaaagcttctgttgctgccttggatgcacacggagaacttgctaaacat
gcttacgaagaaacaggtcgtggtgtctttgaagataaagcaacaaaaaatctatttgct
tgtgagcatgtggttaataacatgcgccatcaaaaaacagtagggattattgaagaagat
gacgtgacaggtttgacgttgattgctgagccggtgggtgttatctgtgggattacgcca
acaactaacccgacttcaacagctatctttaaatctttgatctcgttaaaaacacgtaat
ccaatcatttttgctttccacccatctgctcaagaatcatcagcacatgccgctcggatt
gttagagacgctgctatcgccgctggtgctcctgagaactgtgttcagtgggttgaaaca
ccatcacttgaagcaacaaatgctttgatgaatcatgatggcattgcaaccatccttgct
acaggtggaaatgctatggttaaagcagcttactcatgtggaaaacctgctcttggggta
ggtgcaggtaatgttccagcctatgtggaaaaatctgctaacatccgccaagcagctcat
gatattgttatgtcaaaatcatttgacaacggtatggtctgtgcatctgaacaagctgtt
atcgtggacaaagaaatctatgacgattttgttgcagagttcaaatcttaccatacttat
tttgtaaataaaaaagaaaaagcccttcttgaagaattctgttttggtgcaaaagctaac
agtaaaaactgtgctggcgctaaattgaatccaaacattgttgggaaagcagctacttgg
attgcagaacaagctggatttactgttccagaaggaaccaatattcttgctgcagaatgt
aaagaagtttcagaaaatgaacctttaacacgtgaaaaattatctccagtcattgctgtc
ttgaaatctgaatcacgtgaagacggtgttgaaaaagctcgtcaaatggttgaatttaat
ggacttggtcactcagctgccattcatacagcagatgcagagttggcaaaagaatttggt
actagaattcgtgctatccgtgtcatctggaattcaccttctacatttggtggtatcggt
gatgtttacaatgctttcttaccatcattgaccttaggatgtggttcttatggccgcaac
tcagttggtgataacgttagtgctgttaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagtcccttcaaaaacatacttcgaacgtgattcaatt
caataccttcaaaaatgccgtgacgttgaacgcgtgatgattgttactgaccatgccatg
gttgaacttggtttcttggatcgtatcattgaacaattggaccttcgtcgtaataaagtg
gtttaccaaatctttgcagatgttgaaccagatccagatattacaacagttatgaaaggt
actgaattaatgcgtaccttcaaaccagataccattattgcccttgggggtggttctcca
atggatgctgccaaagtaatgtggttattctacgagcaaccagaagttgatttccatgac
cttgtccaaaaattcatggatattcgtaaacgtgctttcaaattcccagaacttggtaag
aaaacaaaattcattgccattccaactacatctggtacaggttcagaggtaacaccattt
gctgttatttcagacaaggttaacaaccgtaagtacccaattgctgactactcattgaca
ccaactgtggcaattgttgacccagctttggtattgacagttccaggctttattgctgca
gatactggtatggacgttttgacacacgccacagaagcttatgtatctcaaatggctaac
gactttacagatggtttggcgcttcaagcaattaagattgtctttgaaactcttgaaaaa
tctgttaaagaagctgactttgagtcacgtgaaaaaatgcataatgcttcaacaatggca
ggtatggcatttgccaatgcttttctaggtatttctcactcaatggcacataagattggt
gcacaattccacactgttcatggtcgtaccaatgcaatcttgcttccatacgttatccgt
tacaacggtacacgtccagctaagactgcaacatggcctaagtacaattactaccgtgcg
gatgaaaaataccaagacattgcgaaattgttaggacttccagcttcaacaccagaagaa
gccgttgagtcttatgcgaaagctgtttatgaccttggttgccgtgttggcattaagatg
aacttcaaagatcaaggaattgatgagaacgagtggaaagaacattcacgtgccttggct
taccttgcttatgaagaccaatgttcgcctgctaacccacgcttaccaatggttgaccat
atgcaagaaatcattgaagatgcttactatggttatgcagagcgcccaggacgccgtaaa
taa

DBGET integrated database retrieval system