KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0060Help
Entry
GGS_0060          CDS       T02269                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00010  Glycolysis / Gluconeogenesis
sda00071  Fatty acid degradation
sda00350  Tyrosine metabolism
sda00625  Chloroalkane and chloroalkene degradation
sda00626  Naphthalene degradation
sda01100  Metabolic pathways
sda01110  Biosynthesis of secondary metabolites
sda01120  Microbial metabolism in diverse environments
sda01130  Biosynthesis of antibiotics
sda01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GGS_0060 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    GGS_0060 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    GGS_0060 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GGS_0060 (adhA)
   00626 Naphthalene degradation
    GGS_0060 (adhA)
Enzymes [BR:sda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GGS_0060 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 DUF2675 Methyltransf_31 TrkA_N
Motif
Other DBs
NCBI-ProteinID: BAM60252
UniProt: M4YW93
Position
59786..60802
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNEASTGVEVVDHEMPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLQVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGPGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPDVFDEMERGLIQGRKVLDFTR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagttgttaatgaagctagtacaggtgttgaagttgttgatcatgaaatg
ccatcaattgggcacggagaagcacttgttaaagtcgaatactgtggtgtttgccataca
gatttgcacgtagcgcatggcgattttgggcaagttcctgggcgtattctaggccatgaa
ggcattggtatcgtcgaagaaattggtgaaggtgtaacctcattacaagttggtgatcgt
gtctctattgcttggttctttgagggttgtggccattgtgaatattgtacgactggtcgt
gaaactctctgccgttctgttaaaaatgcaggttacagcgttgatggaggaatgagcgaa
tatgctgtcgtaacagctgattacgctgtaaaagtccctgaaggacttgatcctgcccaa
gcttcatcaatcacatgtgcgggtgtcactacttataaagctatcaaagaagcgggtgct
gctccaggtcaatggattgttatttttggtgctgggggtcctggaaacctagctgttcaa
tacgctaagaaagtctttaatgctcatgttgtcgcagtcgatatcaacaatgataaacta
gagttggctaaagaagtcggcgctgatattgtggttaatggtaaagaaattgaagatgtt
ccaggttatattcaggaaaaaacaggtggagcccatggtgtcgttgtaacagctgtttcc
aaagttgcctttaaccaagcgattgatagcgtccgtgcaggaggaactgttgtagctgta
ggccttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaa
gtggtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgttccggttgtcgaaaaagttccagttgatactgctccagatgtcttt
gatgaaatggaacgtggcttgattcaaggacgcaaagttttggattttactcgctaa

DBGET integrated database retrieval system