KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0061Help
Entry
GGS_0061          CDS       T02269                                 

Gene name
thnsl
Definition
threonine synthase-like protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GGS_0061 (thnsl)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GGS_0061 (thnsl)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GGS_0061 (thnsl)
Enzymes [BR:sda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GGS_0061 (thnsl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
60996..62480
Genome map
AA seq 494 aa AA seqDB search
MPMMYQSTRDQENKVTASQAILQGLAADGGLFTPVSFPKLALSFNKLKDESYQAIAKLVL
SAFFDDFTEDEIEYCISSAYGDKFDTSLIAPVVSLTDSHHLELFHGTTIAFKDMALSILP
YLLTTAAKKQGVEQKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPHAGVSKIQELQMT
TQVGENTHVVAIEGNFDDAQTDVKRMFNDPDLAQKLAARGMQLSSANSMNIGRLIPQVVY
YIYAYAQLVKAGQIEAGQNINITVPTGNFGNILAAYYAKKIGLPVATFICASNENRVLTD
FFTSGIYDKKRPFKITTSSSMDILVSSNLERLVFHLVGDNAEKTKCLMDTLTRNGSYELQ
DSDEAIFSQFVAGFATEAETAAEIKRVFELDDYVMDPHTAVASAVYQNYRHETGDDTPTL
IASTASPYKFPSVVVEAITGEPVADDFEAVSQLKQLSHVVQPKAVIGLQNARVRHRLLVK
TADMQTAVENYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgatgtaccaatcaacacgagatcaagagaataaagtgacggcaagtcaagct
attttgcaaggtttagctgcagatggaggattatttacacctgttagttttcctaagtta
gcattgtcatttaacaagcttaaagatgaaagttatcaagccattgccaagctagtgcta
tccgctttttttgatgattttactgaagatgaaattgagtactgtatcagctcagcttat
ggtgataaatttgacacctctcttattgcaccagtagtttctctaacagactctcatcac
ttggaattgtttcacggaacaacgattgctttcaaagatatggctctgtctattttgcct
tatcttttgaccactgcagctaaaaagcaaggcgtggaacagaaaattgtgattttaaca
gctacttctggagatacaggtaaagctgctatggcaggttttgcagatgttcctggaaca
gaaattattgttttttatcctcacgcaggtgttagtaagattcaagaattacaaatgaca
actcaagttggagaaaatactcacgttgttgccattgaggggaattttgatgatgctcaa
acagatgtgaaacgtatgtttaatgaccctgacttggctcagaaattagcagctcgcggg
atgcaactctcatctgcaaactccatgaatattggtcgtcttattccacaagtggtttat
tatatttatgcttatgctcaattggttaaagctggtcagattgaagcaggtcaaaacatt
aatattacggttcctactggtaattttgggaatattttagccgcttattatgccaagaaa
attggtctacctgtagcaacatttatttgtgcttctaatgagaacagggtcttaacggat
ttctttaccagtggtatctatgataaaaaacggcccttcaaaatcacaacaagttcttct
atggatattttggtatcatctaatttagaacgtcttgttttccatttagtaggggataat
gctgaaaaaaccaaatgtttaatggatactctaacaagaaatggatcctacgaattacaa
gatagtgatgaggctattttttctcagtttgttgctggttttgccacagaagcagaaaca
gcggctgaaattaaacgagtatttgagttagacgattatgttatggatcctcataccgca
gttgcttcggcagtttatcaaaattatcgtcacgagacaggggatgacacaccgacactc
attgcctcaacagccagtccttataaatttccgagtgttgttgtagaagcaattactgga
gaaccggtcgccgatgactttgaagcagtgagtcaacttaaacagctttctcacgtggta
caaccaaaagctgtgataggattgcaaaacgcaagggttcggcaccgtctgcttgtgaaa
acggcagatatgcagacagctgttgaaaattatcttggtctgtaa

DBGET integrated database retrieval system