KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0296Help
Entry
GGS_0296          CDS       T02269                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GGS_0296
   01230 Biosynthesis of amino acids
    GGS_0296
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GGS_0296
   00051 Fructose and mannose metabolism
    GGS_0296
   00562 Inositol phosphate metabolism
    GGS_0296
Enzymes [BR:sda01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GGS_0296
Exosome [BR:sda04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GGS_0296
  Exosomal proteins of bladder cancer cells
   GGS_0296
  Exosomal proteins of melanoma cells
   GGS_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
302556..303233
Genome map
AA seq 225 aa AA seqDB search
MKTNLNRHFFVFNPKSYLYGEQLYQLAELADSLVTDDISIFMTAPYAELAELSKRTKHII
VTAQHMDGISPGRGMGKVLPESLVVNGVRAVFLNHAENPMTLTELVQALERAKALELITI
VCADSVAEARAIAVLNPNIILCEPTALIGTGQTSDLSYIQETNAAVKAINPDILMMQAAG
VSQADDVYQVIKAGADGTGCTSGIVKATSPKQMFQDMIAALQKAL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaaccttaatcgtcatttctttgtttttaatcccaagtcctacctatatggg
gaacagctttaccaattagcagagttggccgatagcctagtcactgatgatatcagtatc
tttatgacagcgccttacgccgaattagcagagcttagcaaacgcactaagcatatcatt
gtaactgctcaacacatggatggcatctcgcctggccgtggtatggggaaggttttgcca
gaatccttagtggtaaatggtgtcagagcagtttttttaaaccatgccgaaaatccgatg
accttgacagagttagttcaagcccttgaaagggctaaggctttggaattaataacgatt
gtttgtgcagattctgttgcagaagccagagccattgccgttttaaaccccaatattatt
ttatgcgaacccaccgcgcttattggcactggccaaactagcgatttatcctatattcaa
gagaccaatgctgccgtcaaagctatcaatccagatattttgatgatgcaggctgcagga
gtaagtcaagccgatgatgtttaccaagtgatcaaggcaggtgcagatggcacaggctgt
actagtggtatcgtgaaagcaacatcacccaaacaaatgtttcaagacatgatagcagcc
ttacaaaaggctctctaa

DBGET integrated database retrieval system