KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0373Help
Entry
GGS_0373          CDS       T02269                                 

Gene name
dapE
Definition
acetylornithine deacetylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sda01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sda00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
380936..382348
Genome map
AA seq 470 aa AA seqDB search
MSSTPFLALRRKSMEMSTIEEQLKDCWEHPITKDYLVVLRQLIAHRSIFAQQLGLEETAQ
FLKEIFSAAGAQVIVDQSYAAPFVLATFKSPRPDAKTVIFYQHYDTVPADSDQKWSSDPF
TLTEREGHLYARGVDDDKGHIIARLTALVKYLSQAQTLPVTIVFMMEGAEESASVDLEKY
LKKYARNLQEADLLIWEQGIRNEQDQLELTGGNKGILTFDMTVESAKLDIHSKYGGVIDS
ATWYLLEAIASLRDRNGRLLVPAIYEQVQEPTKRELDLIEIYAIEQLDDLKKLYGLELPM
LQSERRDFLKTYYYQPSIGIQGIQSGYQGQGVKTIIPSQASAKMEVRLVPGLDPKIVFEQ
IQTHLLDKGFDKVNVTYTLGEKSYRSDLSAPAIQQVIDVAKPLYPKGLSLLPTSAGTGPM
HTVFEALGVPIVAFGLGHANSRDHAGDENIAIADYCRHIVLIEELLKSYE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgtctagcacgccctttcttgcattaaggaggaaaagtatggagatgtccacaatagag
gaacagttaaaagattgttgggagcaccctataaccaaagattatctagtcgtgctgcgt
cagttaattgctcaccgctctatttttgcacaacaactagggcttgaagaaactgctcag
tttttaaaagagatttttagtgctgcaggagctcaagttattgtggatcagtcctatgcg
gctccttttgtattagctacctttaagagccctcggccagatgccaagacagtcattttt
tatcagcactatgacacggtacctgctgattctgaccaaaaatggtctagtgatcccttt
accttaacagaacgagaaggtcatttgtatgcaagaggcgtagatgatgataaggggcat
attattgctaggttaacagctcttgtgaaatacctttctcaagcacagactctgcctgtt
accattgtgtttatgatggaaggcgcagaagaatctgcctcagtagacttagaaaaatat
ctgaaaaagtatgcaaggaacttgcaggaagcagacctcttgatttgggaacaaggtatt
cgcaatgaacaagaccaattggaattaactggcggcaataaagggattttaacctttgat
atgactgttgagagtgctaagcttgatatccattctaaatacggtggggtaattgattca
gcaacctggtatttgctagaagctatcgcttctttgcgagataggaatggccgtctttta
gtgccagccatttatgagcaggtgcaagaaccaactaagcgagaactagatttgattgag
atctatgctatcgaacagttggatgatttaaaaaagctttacggactagagcttcctatg
ttacaatcagaacggcgtgattttttgaaaacctattattaccaaccgtccataggtatt
caaggaatacagtcgggttatcagggacagggcgtcaaaaccattattccttcacaggct
tccgctaagatggaggttcgtctagtgcctggacttgatcccaaaatcgtgttcgagcag
attcaaactcatttgttggacaaaggttttgataaggtcaatgtgacctatacgttggga
gaaaaaagttatcgtagtgatttgtctgcgccagctattcaacaagtgatagatgtggcg
aagcccctttaccccaaaggattatcccttttaccaacgtcagctggaacagggcctatg
cacactgtctttgaagcacttggagttccaattgtagcatttgggttgggtcatgctaat
agtcgggatcatgcaggcgatgaaaatattgctatcgcagattactgtcgccatatcgta
ctaatagaggagttattaaaatcttatgaatga

DBGET integrated database retrieval system