KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0505Help
Entry
GGS_0505          CDS       T02269                                 

Gene name
fpg
Definition
formamido pyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sda00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    GGS_0505 (fpg)
Enzymes [BR:sda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     GGS_0505 (fpg)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     GGS_0505 (fpg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513071..513919
Genome map
AA seq 282 aa AA seqDB search
MSLKETIMPELPEVETVRRGLESLVLGQEIVAVKVEVPKMVKSDLRIFLQTLPGQTIQTI
GRRGKYLVFDFGQTVLVSHLRMEGKYLLFPDEVPEQKHFHVFFTLKNGSTLVYQDVRKFG
TFDLIPKSQLSDFFAQRKLGPEPKKETFKLKPFEVALQSSKKLIKPYLLDQTLVAGLGNI
YVDEVLWAAKVHPERLSFSLKKAEIKRLHDETIRILQLGIEKGGSTVRTYRNALGADGTM
QHYLQVYGQAGKPCPRCGQAISKLKVGGRGTHICPKCQKKRS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgtccttgaaggaaacaattatgccagaattaccagaagttgaaacggttcgacgagga
ctcgagtctttagtgctaggtcaggaaattgttgctgtcaaggtagaagtgcctaagatg
gtcaagtcggatttgaggatttttcttcagacattacctggccaaaccattcaaaccatt
ggtcggcggggtaaatatttagtgtttgatttcggtcagacggtccttgtgtcacatcta
cgcatggaaggtaagtatttgctttttccagatgaggtgcctgaacagaaacattttcat
gttttctttaccttaaaaaatggatcgaccttagtgtatcaagacgtgcgtaaatttggg
acctttgatcttattcctaaatcccaattgtcagatttttttgcccaacgaaaacttggt
ccagaaccaaagaaagagacctttaaacttaaaccgtttgaagttgctctgcaatcttcc
aaaaaactaatcaagccctatcttttggatcagacgcttgttgctggtttaggaaatatt
tatgttgatgaagtactctgggcagctaaagttcaccctgagcgtctctcttttagttta
aaaaaggcggagataaaacggctacatgatgaaaccattcgtatcttgcagctagggatt
gaaaaaggtggttcaactgttcggacctatcgaaatgctttaggagcggatgggacgatg
cagcattatttgcaggtgtatggccaagcaggaaaaccttgcccacgttgtggtcaggct
attagtaaactaaaagttggaggaagggggacacacatttgtccgaaatgtcagaaaaaa
aggtcctaa

DBGET integrated database retrieval system