KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0637Help
Entry
GGS_0637          CDS       T02269                                 

Definition
(GenBank) putative fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00010  Glycolysis / Gluconeogenesis
sda00030  Pentose phosphate pathway
sda00051  Fructose and mannose metabolism
sda00680  Methane metabolism
sda01100  Metabolic pathways
sda01110  Biosynthesis of secondary metabolites
sda01120  Microbial metabolism in diverse environments
sda01130  Biosynthesis of antibiotics
sda01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GGS_0637
   00030 Pentose phosphate pathway
    GGS_0637
   00051 Fructose and mannose metabolism
    GGS_0637
  Energy metabolism
   00680 Methane metabolism
    GGS_0637
Enzymes [BR:sda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     GGS_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: BAM60793
UniProt: M4YX85
Position
651134..653080
Genome map
AA seq 648 aa AA seqDB search
MMTSDKEWLPNMSKYYRLLKEKFPTKSSLATEMINLEAICHLPKGTEHFLSDLHGEYEAF
DYLLRNGSGSIKKKLQECFPDKDPGTIDLLCQYIYYPAEKINANTLLSEQALQEELTSFL
PDLLQLVKYIGGKYTRSKVRKLLPKDYAYIMEELLTEGQPDKNKENYYSAIIGKVIELKQ
LENLFIAFATLIQQLAIDHLHVVGDIFDRGKYPDLILDRLMTFQHIDIQWGNHDITWMGA
VSGSMICMVNVIRIAARYNSIELIEDRYGINLRRLIDYSQTYFTPKVVFQPILDGDVISE
QDERVLNCLQQATALLQFKLEHQLIHRRPEFEMMASSALDRIRPESEEMLVGEKTYPLTD
FPFDMVDWQTPGSLTTEEEDLLNDLLERFQQSNRLRHHIEFLFSKGAIYHISNNHLLYHG
CIPMHSNGDFKSICLQGHFLSGKTLMDFYEEKVRQAYQHPDIQDDFATDLFWYLWCGEGS
SLFGKQRMTTFERYYIEDKETHKEKKNPYYHLREKEGICQRLLAEFTLDETGHIVNGHTP
VQEKSGEIPIKAGGKMIIIDGGLAKGYQKKTGIAGYTLISNSYGLELVAHNPFSSVEAVL
NGECDIIFIKRLVEEVAERTLVKQTDNGKELLKEIEDLHYLYHHFDEY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaagcgataaggagtggttaccgaacatgtcaaagtactatcgtctcttgaaa
gaaaaattcccaacaaagtcttctctggctaccgaaatgattaacctagaagccatttgc
catttgcccaaaggaaccgagcattttctgagtgatcttcatggagaatatgaggccttt
gattacctcttgcgaaatggttctggatccatcaaaaagaaattacaggaatgttttccc
gacaaagaccctgggaccattgacctgctttgtcagtacatttactaccctgctgaaaaa
atcaatgctaataccttgttgtcggaacaagcattgcaagaagaattaaccagctttcta
cccgacttattacagttggttaagtacatcggaggcaagtatactcgctctaaagtgaga
aaattgttacccaaagattatgcctatatcatggaagaattgttgacggaaggccaacct
gataaaaataaagaaaattattattcagcaattattggtaaagtgattgaactcaagcag
ttggaaaatctctttattgcttttgcgaccttgattcagcagttagccattgatcatttg
cacgtggtgggagatatttttgaccgtgggaaatacccagacttgattttggatcggctc
atgacttttcagcatattgatattcagtggggcaaccacgacatcacctggatgggggca
gtttctgggtcgatgatttgcatggtcaatgtgattcggattgcagcgaggtacaacagc
attgagctcattgaagaccgctacggaattaaccttcgtcgcttgattgattatagccaa
acctactttacccctaaggtcgtttttcagcctattttggatggggatgtgatttcagaa
caagatgagcgggtgttgaattgtttgcagcaggctacagctttactacagttcaagttg
gaacatcaattgattcaccgtcggcctgaatttgagatgatggcatcgagcgccttagac
cgcattcgaccagaaagtgaggaaatgctggtgggtgagaaaacctacccactaactgat
tttccttttgacatggtggactggcaaactcctggaagcctaaccacagaagaagaggac
ttattgaacgatttgcttgagcgtttccaacaatcaaaccgcctgcgtcatcacatagaa
ttcctcttttcgaaaggcgctatctatcatatttccaataatcacttgctttatcacggt
tgtatccccatgcattccaacggtgattttaaatccatttgcttacagggacacttttta
tctggcaaaaccctgatggatttttacgaagaaaaagtgaggcaggcctaccaacaccct
gatattcaggacgattttgcgaccgatttgttttggtatttgtggtgtggagaagggtct
tctctatttggcaagcagcgcatgaccactttcgaacgttattatatcgaggataaggaa
acccataaagaaaagaaaaatccttattatcacttaagggaaaaagaaggcatctgccaa
cgtcttttggctgaatttaccttggatgagacagggcatattgtcaatgggcacacgcct
gtccaggaaaagagtggtgagattccgattaaagctggtgggaaaatgattattattgat
ggtggattggcgaaaggttatcagaaaaaaacaggtatcgcaggctataccttaatttcc
aacagttacggcttagagttggtggctcataaccccttttcatcagtggaagctgtttta
aatggagaatgtgacattatttttatcaaacgattggtcgaagaagtggccgaacgtacc
ttggtcaaacagacagataatggcaaggagctcctcaaagaaattgaagacctgcattac
ctctaccaccattttgatgagtattaa

DBGET integrated database retrieval system