KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0637Help
Entry
GGS_0637          CDS       T02269                                 

Definition
putative fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sda01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sda00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sda00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sda00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sda00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651134..653080
Genome map
AA seq 648 aa AA seqDB search
MMTSDKEWLPNMSKYYRLLKEKFPTKSSLATEMINLEAICHLPKGTEHFLSDLHGEYEAF
DYLLRNGSGSIKKKLQECFPDKDPGTIDLLCQYIYYPAEKINANTLLSEQALQEELTSFL
PDLLQLVKYIGGKYTRSKVRKLLPKDYAYIMEELLTEGQPDKNKENYYSAIIGKVIELKQ
LENLFIAFATLIQQLAIDHLHVVGDIFDRGKYPDLILDRLMTFQHIDIQWGNHDITWMGA
VSGSMICMVNVIRIAARYNSIELIEDRYGINLRRLIDYSQTYFTPKVVFQPILDGDVISE
QDERVLNCLQQATALLQFKLEHQLIHRRPEFEMMASSALDRIRPESEEMLVGEKTYPLTD
FPFDMVDWQTPGSLTTEEEDLLNDLLERFQQSNRLRHHIEFLFSKGAIYHISNNHLLYHG
CIPMHSNGDFKSICLQGHFLSGKTLMDFYEEKVRQAYQHPDIQDDFATDLFWYLWCGEGS
SLFGKQRMTTFERYYIEDKETHKEKKNPYYHLREKEGICQRLLAEFTLDETGHIVNGHTP
VQEKSGEIPIKAGGKMIIIDGGLAKGYQKKTGIAGYTLISNSYGLELVAHNPFSSVEAVL
NGECDIIFIKRLVEEVAERTLVKQTDNGKELLKEIEDLHYLYHHFDEY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaagcgataaggagtggttaccgaacatgtcaaagtactatcgtctcttgaaa
gaaaaattcccaacaaagtcttctctggctaccgaaatgattaacctagaagccatttgc
catttgcccaaaggaaccgagcattttctgagtgatcttcatggagaatatgaggccttt
gattacctcttgcgaaatggttctggatccatcaaaaagaaattacaggaatgttttccc
gacaaagaccctgggaccattgacctgctttgtcagtacatttactaccctgctgaaaaa
atcaatgctaataccttgttgtcggaacaagcattgcaagaagaattaaccagctttcta
cccgacttattacagttggttaagtacatcggaggcaagtatactcgctctaaagtgaga
aaattgttacccaaagattatgcctatatcatggaagaattgttgacggaaggccaacct
gataaaaataaagaaaattattattcagcaattattggtaaagtgattgaactcaagcag
ttggaaaatctctttattgcttttgcgaccttgattcagcagttagccattgatcatttg
cacgtggtgggagatatttttgaccgtgggaaatacccagacttgattttggatcggctc
atgacttttcagcatattgatattcagtggggcaaccacgacatcacctggatgggggca
gtttctgggtcgatgatttgcatggtcaatgtgattcggattgcagcgaggtacaacagc
attgagctcattgaagaccgctacggaattaaccttcgtcgcttgattgattatagccaa
acctactttacccctaaggtcgtttttcagcctattttggatggggatgtgatttcagaa
caagatgagcgggtgttgaattgtttgcagcaggctacagctttactacagttcaagttg
gaacatcaattgattcaccgtcggcctgaatttgagatgatggcatcgagcgccttagac
cgcattcgaccagaaagtgaggaaatgctggtgggtgagaaaacctacccactaactgat
tttccttttgacatggtggactggcaaactcctggaagcctaaccacagaagaagaggac
ttattgaacgatttgcttgagcgtttccaacaatcaaaccgcctgcgtcatcacatagaa
ttcctcttttcgaaaggcgctatctatcatatttccaataatcacttgctttatcacggt
tgtatccccatgcattccaacggtgattttaaatccatttgcttacagggacacttttta
tctggcaaaaccctgatggatttttacgaagaaaaagtgaggcaggcctaccaacaccct
gatattcaggacgattttgcgaccgatttgttttggtatttgtggtgtggagaagggtct
tctctatttggcaagcagcgcatgaccactttcgaacgttattatatcgaggataaggaa
acccataaagaaaagaaaaatccttattatcacttaagggaaaaagaaggcatctgccaa
cgtcttttggctgaatttaccttggatgagacagggcatattgtcaatgggcacacgcct
gtccaggaaaagagtggtgagattccgattaaagctggtgggaaaatgattattattgat
ggtggattggcgaaaggttatcagaaaaaaacaggtatcgcaggctataccttaatttcc
aacagttacggcttagagttggtggctcataaccccttttcatcagtggaagctgtttta
aatggagaatgtgacattatttttatcaaacgattggtcgaagaagtggccgaacgtacc
ttggtcaaacagacagataatggcaaggagctcctcaaagaaattgaagacctgcattac
ctctaccaccattttgatgagtattaa

DBGET integrated database retrieval system