KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0637Help
Entry
GGS_0637          CDS       T02269                                 

Definition
putative fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GGS_0637
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GGS_0637
   00030 Pentose phosphate pathway
    GGS_0637
   00051 Fructose and mannose metabolism
    GGS_0637
  Energy metabolism
   00680 Methane metabolism
    GGS_0637
Enzymes [BR:sda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     GGS_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651134..653080
Genome map
AA seq 648 aa AA seqDB search
MMTSDKEWLPNMSKYYRLLKEKFPTKSSLATEMINLEAICHLPKGTEHFLSDLHGEYEAF
DYLLRNGSGSIKKKLQECFPDKDPGTIDLLCQYIYYPAEKINANTLLSEQALQEELTSFL
PDLLQLVKYIGGKYTRSKVRKLLPKDYAYIMEELLTEGQPDKNKENYYSAIIGKVIELKQ
LENLFIAFATLIQQLAIDHLHVVGDIFDRGKYPDLILDRLMTFQHIDIQWGNHDITWMGA
VSGSMICMVNVIRIAARYNSIELIEDRYGINLRRLIDYSQTYFTPKVVFQPILDGDVISE
QDERVLNCLQQATALLQFKLEHQLIHRRPEFEMMASSALDRIRPESEEMLVGEKTYPLTD
FPFDMVDWQTPGSLTTEEEDLLNDLLERFQQSNRLRHHIEFLFSKGAIYHISNNHLLYHG
CIPMHSNGDFKSICLQGHFLSGKTLMDFYEEKVRQAYQHPDIQDDFATDLFWYLWCGEGS
SLFGKQRMTTFERYYIEDKETHKEKKNPYYHLREKEGICQRLLAEFTLDETGHIVNGHTP
VQEKSGEIPIKAGGKMIIIDGGLAKGYQKKTGIAGYTLISNSYGLELVAHNPFSSVEAVL
NGECDIIFIKRLVEEVAERTLVKQTDNGKELLKEIEDLHYLYHHFDEY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaagcgataaggagtggttaccgaacatgtcaaagtactatcgtctcttgaaa
gaaaaattcccaacaaagtcttctctggctaccgaaatgattaacctagaagccatttgc
catttgcccaaaggaaccgagcattttctgagtgatcttcatggagaatatgaggccttt
gattacctcttgcgaaatggttctggatccatcaaaaagaaattacaggaatgttttccc
gacaaagaccctgggaccattgacctgctttgtcagtacatttactaccctgctgaaaaa
atcaatgctaataccttgttgtcggaacaagcattgcaagaagaattaaccagctttcta
cccgacttattacagttggttaagtacatcggaggcaagtatactcgctctaaagtgaga
aaattgttacccaaagattatgcctatatcatggaagaattgttgacggaaggccaacct
gataaaaataaagaaaattattattcagcaattattggtaaagtgattgaactcaagcag
ttggaaaatctctttattgcttttgcgaccttgattcagcagttagccattgatcatttg
cacgtggtgggagatatttttgaccgtgggaaatacccagacttgattttggatcggctc
atgacttttcagcatattgatattcagtggggcaaccacgacatcacctggatgggggca
gtttctgggtcgatgatttgcatggtcaatgtgattcggattgcagcgaggtacaacagc
attgagctcattgaagaccgctacggaattaaccttcgtcgcttgattgattatagccaa
acctactttacccctaaggtcgtttttcagcctattttggatggggatgtgatttcagaa
caagatgagcgggtgttgaattgtttgcagcaggctacagctttactacagttcaagttg
gaacatcaattgattcaccgtcggcctgaatttgagatgatggcatcgagcgccttagac
cgcattcgaccagaaagtgaggaaatgctggtgggtgagaaaacctacccactaactgat
tttccttttgacatggtggactggcaaactcctggaagcctaaccacagaagaagaggac
ttattgaacgatttgcttgagcgtttccaacaatcaaaccgcctgcgtcatcacatagaa
ttcctcttttcgaaaggcgctatctatcatatttccaataatcacttgctttatcacggt
tgtatccccatgcattccaacggtgattttaaatccatttgcttacagggacacttttta
tctggcaaaaccctgatggatttttacgaagaaaaagtgaggcaggcctaccaacaccct
gatattcaggacgattttgcgaccgatttgttttggtatttgtggtgtggagaagggtct
tctctatttggcaagcagcgcatgaccactttcgaacgttattatatcgaggataaggaa
acccataaagaaaagaaaaatccttattatcacttaagggaaaaagaaggcatctgccaa
cgtcttttggctgaatttaccttggatgagacagggcatattgtcaatgggcacacgcct
gtccaggaaaagagtggtgagattccgattaaagctggtgggaaaatgattattattgat
ggtggattggcgaaaggttatcagaaaaaaacaggtatcgcaggctataccttaatttcc
aacagttacggcttagagttggtggctcataaccccttttcatcagtggaagctgtttta
aatggagaatgtgacattatttttatcaaacgattggtcgaagaagtggccgaacgtacc
ttggtcaaacagacagataatggcaaggagctcctcaaagaaattgaagacctgcattac
ctctaccaccattttgatgagtattaa

DBGET integrated database retrieval system