KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0693Help
Entry
GGS_0693          CDS       T02269                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sda00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
714876..716756
Genome map
AA seq 626 aa AA seqDB search
MDNELALYTFGTGENNQLQDYLGVHRVDIDHKTAYVFRVWAPNAEEVSLIGDFTDWKANP
LSMFRHEAGVWEVTTPLAKEGDIYKYLVKRQCGHVVEKIDPLAVLFEARPGTGAVVKTLP
DKKWRDSLWMGRRKRFGFRERPVNIYEVHANSWKKDETGKPYDMSRLKEELIPYLKKMHY
THVEFLPVMTHPLDMSWGYQLMGYFAFDSTFGSPEDFQDFVEACHLNNIGVIVDWVPGHF
TQNDDALAYFDGTPTFEYQDHHRARNYGWGALNFDLGKNQVQSFLISSALFWLETYHIDG
IRVDAVSNMLYLDYDQGPWTPNIHGGNQNLEGVAFLQKLNRVIKEKHPDVMMIAEESSSA
TPITSPIEEGGLGFDYKWNMGWMNDILRFYEEDPYYRQFDFNLLTFSFVYCFNERYILPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLYTYQMCHPGKKLLFMGSEFGQFLEWKYNDQ
LEWHDLEDHFNAKLQRFTAELNQFYKDHSMLWQNDETYDSIDIIDADNKQESVLSFCRLN
NKGELLLCVFNMTPVERPDFTIGVPVAGIYEEVFNTEMEAYGGVWKEHNPITKTVQAQWK
EYHQTLSFTLPALGASIWKVKRRQKD
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgagttggcgctttacacatttggcaccggggagaataaccagttgcaagat
tacttgggtgttcaccgggttgacatagatcataaaactgcttacgtcttcagggtgtgg
gctccgaatgcagaagaagtgagtctaataggcgattttactgactggaaagctaaccct
ttaagcatgtttaggcatgaggcgggtgtttgggaggtaaccacaccattagctaaagaa
ggggatatttacaaatacctggttaaacggcaatgtggtcacgttgtcgagaaaattgat
cctcttgctgtcttgtttgaagctaggccagggacaggagctgttgttaaaacattacca
gataaaaaatggcgagatagtttgtggatggggcgaaggaaacgctttgggtttagagaa
agacctgttaacatctatgaggtccacgctaattcttggaagaaggatgaaactggaaag
ccatatgacatgtctcgcttgaaagaagagctgattccttatctcaaaaagatgcattat
actcatgtagaatttcttcctgtcatgacgcatcctttggacatgagctggggataccaa
ctgatggggtattttgcttttgattcgacctttggtagcccagaggatttccaggacttt
gtcgaagcttgtcaccttaataatattggcgttattgtcgactgggtaccagggcatttt
acacaaaatgatgatgctttagcttactttgatggaacgccaacctttgagtatcaagac
catcatcgagcgcggaattatggctggggggctttgaactttgatttaggtaaaaatcag
gtacagtctttcttaatctccagtgccttattttggttagaaacttatcatattgatggt
atccgggtagatgcggttagcaacatgttgtatttagattatgatcaagggccgtggaca
cctaatattcatggtggaaaccaaaatcttgaaggggttgcctttcttcaaaaattgaat
cgggtgataaaagaaaaacacccagatgtcatgatgatcgcagaggaatcctcttcagca
acaccgattaccagccctattgaagagggtggactagggtttgattacaaatggaacatg
ggttggatgaatgatattttgaggttctatgaagaagatccttattaccggcaatttgat
ttcaacctcttgacttttagttttgtgtattgtttcaatgaacgctatattctgccattt
tctcatgacgaagtagtgcatggtaagaagagcatgatgcataagatgtggggagatcgc
tataatcaatttgcaggcttgcgaaatctctacacttatcaaatgtgtcatccaggtaaa
aaattactatttatgggctctgaatttggtcaatttttagagtggaagtacaatgatcaa
ctagaatggcatgatttggaagatcactttaatgccaaactacaacggtttacagctgag
ttaaatcagttttataaagatcatagcatgctttggcaaaatgatgagacgtatgacagt
attgatatcattgatgctgataacaaacaagaatcggttttatctttctgtcgcctcaac
aataaaggggaactgttgttgtgcgtctttaacatgacgcctgttgaacgaccagatttt
actataggtgttccagtcgcaggaatctatgaggaagttttcaatactgaaatggaagcg
tatggaggtgtttggaaagaacacaatcctatcactaaaacagtacaagcacaatggaaa
gaatatcatcaaaccctctctttcactttaccagcattgggagcaagtatctggaaggtt
aagcgtcgtcaaaaagactag

DBGET integrated database retrieval system