KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0765Help
Entry
GGS_0765          CDS       T02269                                 

Gene name
arcB
Definition
(GenBank) arginine/ornithine antiporter
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00240  Pyrimidine metabolism
sda00250  Alanine, aspartate and glutamate metabolism
sda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GGS_0765 (arcB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GGS_0765 (arcB)
Enzymes [BR:sda01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     GGS_0765 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: BAM60916
UniProt: M4ZDH7
Position
794635..795585
Genome map
AA seq 316 aa AA seqDB search
MIKGRNMSVVNNRVALTNLVSMETLTNEEVLGLINRGSEYKAGKVALPKLQDQFVANLFF
ENSTRTHKSFEVAEKKLGLTVLDFNADTSAVNKGESLYDTVLTMSALGTDICVIRHPEDD
YYKALVESPTITASIVNGGDGSGQHPSQCLLDLLTIYEEFGRFEGLKIAIAGDLTHSRVA
KSNMQILKRLGAELYFYGPKEWYSEEFDSYGTYTAIDHIIEELDVLMLLRVQHERHDGQQ
SFSKDSYHQQFGLTQERYNALKDSAIIMHPAPVNRDVEIADSLVEAPKARIVSQMTNGVF
VRMAIIEAILNGRSHC
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaggggagaaacatgtcagtcgttaataaccgtgttgcacttaccaatttagtt
tcaatggaaacattaaccaatgaagaagttttaggacttatcaaccgaggttcagaatac
aaagcaggaaaggttgccctacctaaactgcaagatcagtttgtggctaacctctttttt
gaaaattctactagaactcataagtcatttgaagtggccgagaaaaaacttgggttaacc
gttcttgattttaatgcagacacgagtgctgttaataagggagaaagcttgtatgatact
gtgttaaccatgagtgccctagggacagatatttgtgtgattcgtcatcctgaagatgat
tattacaaggccttagtggagagtccaacaatcacagcttcaattgttaatggcggagat
ggttctggacagcatccaagccagtgtcttcttgacttgctaactatttacgaagagttt
gggcgatttgaggggttaaaaattgcgattgcaggggacttgacccattcgcgtgtcgca
aaatcaaacatgcagattttaaaacgactaggagcagagctttatttctatggtcccaaa
gaatggtattcagaagaatttgatagttacgggacttacactgctattgatcacattatt
gaagagttagatgtcctgatgttgcttcgggtgcaacatgagcgtcacgatggtcagcaa
agtttttcaaaagatagttaccatcagcagtttggactgacacaagaacgttacaatgcc
ttaaaggactccgctattattatgcatccagctcctgttaaccgtgatgtggagattgca
gatagtttggtagaagcaccgaaggcaagaattgtttctcaaatgacgaacggtgtcttt
gtacgtatggctattattgaggctattcttaatggcagaagccattgctga

DBGET integrated database retrieval system