KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0840Help
Entry
GGS_0840          CDS       T02269                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GGS_0840 (folP)
Enzymes [BR:sda01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GGS_0840 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884073..884873
Genome map
AA seq 266 aa AA seqDB search
MKIGKFVIDGNAAIMGILNVTPDSFSDGGSYTTVQKALQQVDQLIAGGAKIIDVGGESTR
PGYQFVSAADEIERVVPMIKAIKAKYDVLISIDTYKTETARAALEAGADILNDVWAGLYD
GEMLALAAEYDVPIILMHNQKEEVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPGFG
FAKSVQHNMELLKGLDHVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQLVRVHDVKANQEIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgggaaatttgtgattgacggcaacgctgctattatgggaattttaaatgtg
actcccgattccttttccgatggtggttcatacacgacagtacaaaaagccttacaacag
gtagatcagctaattgctggtggggccaaaattattgatgttggcggtgaatccactcga
ccaggttaccaatttgtgagcgctgctgatgaaattgagcgtgtcgttcccatgattaaa
gccattaaagcaaaatatgatgtgttaatcagtattgatacctacaaaacagaaaccgca
agagcagctttagaagctggtgctgacattttaaatgatgtctgggcaggtttatacgat
ggggaaatgcttgctctagcagcagagtatgatgtgcctattatcttgatgcataaccaa
aaagaagaagtctatcaagatgtaacacaagatgtttgtgattttttgagtgctagagct
caggcagccatagatgctggagtaccaaaagacaatatttggattgatccaggatttgga
tttgccaaatctgttcaacacaatatggagttattaaaaggattggatcatgtttgtcag
ttgggttatcctgtcttgtttggtatttcgagaaagcgtgttgtagatgccttgttaggc
ggcaacaccaaagctaaagagcgagacggagcgacagcagccttatctgcttatgctctt
ggaaaaggctgtcagctggtacgcgtacacgatgtcaaggctaatcaagaaattgtggct
gttttgagtcagttgatgtga

DBGET integrated database retrieval system