KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0840Help
Entry
GGS_0840          CDS       T02269                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sda00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884073..884873
Genome map
AA seq 266 aa AA seqDB search
MKIGKFVIDGNAAIMGILNVTPDSFSDGGSYTTVQKALQQVDQLIAGGAKIIDVGGESTR
PGYQFVSAADEIERVVPMIKAIKAKYDVLISIDTYKTETARAALEAGADILNDVWAGLYD
GEMLALAAEYDVPIILMHNQKEEVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPGFG
FAKSVQHNMELLKGLDHVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQLVRVHDVKANQEIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgggaaatttgtgattgacggcaacgctgctattatgggaattttaaatgtg
actcccgattccttttccgatggtggttcatacacgacagtacaaaaagccttacaacag
gtagatcagctaattgctggtggggccaaaattattgatgttggcggtgaatccactcga
ccaggttaccaatttgtgagcgctgctgatgaaattgagcgtgtcgttcccatgattaaa
gccattaaagcaaaatatgatgtgttaatcagtattgatacctacaaaacagaaaccgca
agagcagctttagaagctggtgctgacattttaaatgatgtctgggcaggtttatacgat
ggggaaatgcttgctctagcagcagagtatgatgtgcctattatcttgatgcataaccaa
aaagaagaagtctatcaagatgtaacacaagatgtttgtgattttttgagtgctagagct
caggcagccatagatgctggagtaccaaaagacaatatttggattgatccaggatttgga
tttgccaaatctgttcaacacaatatggagttattaaaaggattggatcatgtttgtcag
ttgggttatcctgtcttgtttggtatttcgagaaagcgtgttgtagatgccttgttaggc
ggcaacaccaaagctaaagagcgagacggagcgacagcagccttatctgcttatgctctt
ggaaaaggctgtcagctggtacgcgtacacgatgtcaaggctaatcaagaaattgtggct
gttttgagtcagttgatgtga

DBGET integrated database retrieval system