KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1125Help
Entry
GGS_1125          CDS       T02269                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sda00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sda00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1181580..1182923
Genome map
AA seq 447 aa AA seqDB search
MKMKTLLGLSAGKTAQLILKKLGRGSTYPGRLALAFDKDILDSLSKDYEIVVITGTNGKT
LTTALTVGILKEAFGDVLTNPSGANMITGITAAFLSAKKGKSGKHIAVLEIDEASLPKIT
NYLKPSLFVYTNIFRDQMDRYGEIYTTYQMIVDGARNAPKATILANGDSPIFSSKDIVNP
VQYYGFDTAKHAPQLAHYNTEGILCPKCEHILQYRLNTYANLGDFICLNCQFQRPTLDYQ
LTELTAITHQSSEFVIDGQNYKINVGGLYNIYNALAAVSVAEFFGVSPEKIKAGFNKSKA
VFGRQETFKIGDKSCTLILIKNPVGASQALEMIQLADYPFSLSVLLNANYADGIDTSWIW
DANFELITHMPITEINAGGVRHSEIARRLRVTGFDDTKIKQAEKLEQITEAIEKQESKHA
YILATYTAMLEFRSLLADRHVVEKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaagacattactcggtctcagtgccggcaaaacagctcaattgatattaaag
aaactagggcgcggttctacttatcccggccgtttagcactagccttcgataaggatatt
ttagatagcctctcaaaagattatgagattgttgtcatcacaggtaccaatgggaaaaca
ttaacaacagctttaaccgtaggcatcttgaaagaagcatttggcgacgtacttaccaac
ccgagcggtgctaatatgattacggggattaccgcggcttttttatcagctaaaaaagga
aaatctggtaaacacattgctgtcttggaaattgatgaagcaagtcttccaaagattact
aattacctcaaaccaagtctctttgtctacaccaatatttttagagatcaaatggaccgc
tatggggagatttatactacttatcagatgattgtagatggtgctcgaaatgctccaaaa
gcaactattctagccaatggagatagtcctattttctcttctaaggacatagttaatcca
gttcagtattatggttttgatactgctaagcatgctccgcagctagctcattacaacaca
gaagggattttatgtccaaaatgcgaacatattcttcagtatcgtctcaatacttatgcg
aatctaggagactttatttgcttaaactgtcagttccaaagaccaacgttagattatcaa
ttaactgagctcaccgctattactcaccaaagttctgaatttgttattgatggacaaaac
tacaagataaatgtcggtggcttatataatatttacaacgccctcgctgccgtctctgtt
gctgaatttttcggtgtttctcccgagaaaattaaggctggttttaacaaaagcaaggcc
gttttcggtcgccaagaaacctttaagattggagataaatcctgcacccttatccttatc
aagaatcctgttggagccagtcaggcactggaaatgattcaattggcagattatccattt
agcttatcagttttattaaatgccaattacgctgatggcattgataccagctggatttgg
gatgctaatttcgaactcattacacacatgccaattactgagattaatgctggtggtgtc
cgtcactctgaaattgccagaagacttagagtcacaggatttgacgacactaagataaaa
caagctgaaaagctcgagcaaatcacggaagctattgaaaaacaagaaagcaaacatgct
tatattttagcaacctatactgcaatgttagaattccgtagcttgctagccgaccgccat
gttgttgaaaaggagatgaactaa

DBGET integrated database retrieval system