KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1131Help
Entry
GGS_1131          CDS       T02269                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyl transferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00010  Glycolysis / Gluconeogenesis
sda00020  Citrate cycle (TCA cycle)
sda00620  Pyruvate metabolism
sda01100  Metabolic pathways
sda01110  Biosynthesis of secondary metabolites
sda01120  Microbial metabolism in diverse environments
sda01130  Biosynthesis of antibiotics
sda01200  Carbon metabolism
Module
sda_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GGS_1131 (acoC)
   00020 Citrate cycle (TCA cycle)
    GGS_1131 (acoC)
   00620 Pyruvate metabolism
    GGS_1131 (acoC)
Enzymes [BR:sda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GGS_1131 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B
Motif
Other DBs
NCBI-ProteinID: BAM61269
UniProt: M4YX24
Position
complement(1188636..1190045)
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDVLLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPTVAPKEDVASPAPQV
AATAIPQGNGGKVRATPAARKVAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVELPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINNANDIELHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctcggcgttgacatgcaagagggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatgtccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgttctattgaaaattgtt
cgtccagctggtgatactgtacctgtaactgaagttatcggttacattggtgcagaaggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagatgcaggaccaacagtagctccaaaagaagatgtggccagtccagctcctcaggta
gcagcgacagctattccgcaaggaaatggtggaaaagttcgtgctactccagctgcacgt
aaggttgcagcagaaatgggcattgaccttggtcaagttccaggaacaggaccaaaaggg
cgtgtccataaagaagatgttgagaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaatcgctgctgataaaggtatcgacttggcgactgtttcaggtactggcttt
aacggtaaggtcatgaaagaagacatcatggctattcttgaagctgctaaaccagctgaa
gcaaaagcaccagcagctaaagaagaaaaagttgttgagcttccagagggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gcgcctacctttacgcttaactacgatattgatatgacagaaatgatcgcccttcgtaag
aagttaattgacccaatcatggctaaaacaggccttaaagtcagcttcacagacttgatt
ggtatggcagtggttaaaacgttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaataacgctaatgatattgaattgcaccgctttgtgaacctgggtattgccgtaggt
cttgatgatggtcttattgttccagttatccatggtgcagataagatgagcttgtcagat
ttcgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaagcagct
gaaatgtctggatcaaccttctcaatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgtccaattatggcgatgtgcttaaccatc
gaccatcgcttggtagacggtatgaacggtgcaaaattcatggttgacctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system