KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1176Help
Entry
GGS_1176          CDS       T02269                                 

Gene name
malQ
Definition
putative 4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GGS_1176 (malQ)
Enzymes [BR:sda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GGS_1176 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237811..1239307)
Genome map
AA seq 498 aa AA seqDB search
MNKRASGILMHISSLPGKTGIGTFGKAAFDFVDFLKETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHFIDLELLVADGYLQEADLVGVDFGSDPEVVDYAQIFQARRPLLEKAVQAFL
ATKEAVKELAAFEAEASWLGDFAEFMSLKEHFQNKALQEWDDRAIVKREEAALHHYRELL
AESIHYHKVCQYFFYQQWLALKAYANDNGIEIIGDMPIYVSADSVEVWTMPDLFKVDEDK
NPLFIAGVPADGFSEDGQLWGNPIYNWSAHEASNFAWWIYRIQESFKLYDYLRIDHFKGF
SDFWEIPGGDTTARNGHWESAPGLALFAAVREALGELPIIAENLGYIDEKAEQLLASTAF
PGMKILEFGLFDITSQSSDLPHHYDRNCVVYTGTHDNEVVNGWYANLTEEQVTFVNDYLH
KGADESITQAMLRTIFATVSDTAILCMQDLLDKGAESRMNMPNTVGGNWQWRMLEGDITE
EHKAYLTDLTELYDRVNH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacgtgcaagcggtatcttaatgcatattagttcccttcctggtaagaccgga
attggaactttcgggaaggcagcttttgactttgttgatttcctaaaagaaaccaaacaa
acttattggcagattctacctttaacaacgacaagttatggggattcaccttaccaatca
ttttcagctattgcaggtaatactcattttatcgatcttgaattacttgttgcagacggc
tacttgcaggaagctgatctcgttggcgttgattttggttctgaccctgaggtggttgac
tatgctcagatttttcaggcaagacgccccttattagaaaaagcggtccaagcctttctt
gcaactaaagaagccgtcaaagaattggcagcttttgaagcagaagcgagttggttgggt
gactttgccgagttcatgtcattgaaagaacactttcaaaataaggccctacaagaatgg
gatgacagagcaattgtgaaacgcgaagaagcagccttgcatcattaccgtgagttactt
gctgaaagtattcactaccataaagtctgtcaatatttcttctaccaacaatggttggcc
ttaaaagcgtatgccaatgataatggcattgagattattggtgatatgccaatctatgtt
tctgcagatagtgtggaagtttggacaatgccagacttgtttaaagtggacgaggataaa
aacccactctttatcgctggagttcctgcagatggctttagtgaagatggtcaactttgg
ggcaatccgatttacaattggtcagcccatgaagcatccaactttgcttggtggatttac
cgtattcaagaaagtttcaaattatatgactatttgagaattgatcactttaaaggcttt
tcagatttctgggaaattcctggtggcgacacaactgctcgaaatggacattgggaatca
gctccgggacttgctttgtttgcggcagttcgtgaggctttaggagaactgcctatcatc
gcagaaaaccttggttatattgatgaaaaggcagagcagctattagcctcaacagccttt
ccaggaatgaagattttagaatttggcctttttgacattaccagccaaagcagtgattta
ccacatcattatgatcgtaactgtgtggtttatactggtacgcatgataacgaagtggtt
aatggttggtatgcaaaccttacggaagaacaagttacttttgtgaatgactacctccac
aaaggtgcagatgaaagtattacacaagccatgttgcgcacgatttttgcaacagttagt
gatacggctatcttgtgcatgcaagacttgcttgataagggggcagaaagccgcatgaac
atgccaaataccgtgggtggcaattggcaatggcggatgcttgaaggagatatcaccgaa
gagcacaaagcctacttgacagatttgacagaattatacgatcgcgtcaatcattaa

DBGET integrated database retrieval system