KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1272Help
Entry
GGS_1272          CDS       T02269                                 

Definition
glycosyl hydrolase, family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GGS_1272
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    GGS_1272
Enzymes [BR:sda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GGS_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1359355..1361160)
Genome map
AA seq 601 aa AA seqDB search
MKGKEMTHLVDLRKKPYHLDDQAIAWVEETIASMSLEEKIGQLFVNMGASRTEEYLTQVL
NDYKIAAVRYNKGMADEVWEQNYILQTKSKIPLLIAANTEAGGDGAVNDGTKVGDEIKVA
ATNDPKYAYEMGRIAGIEAAAVGCNASFAPIVDLTRNWRNPIIASRNWGSNVDQIITLSK
EYMRGIMEHGIMPFAKHFPGDGIDERDHHLSFASNPMTKDEWMSTFGRIYGELAEAGLPG
IMAGHIHLPNVEKELHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVAMTA
SMPRRLMLPTAVEAGCDLFLFFNDPDEDLQWMKEGYEAGILTEERLHDALRRTLGLKARL
GLHLYEGRREEIMLPKEEAMTLINTKEAQAIADEVADKAITLVKDKQKDIFPVTPERYKR
ILIVNVEGLKGGFGAMIAGQKKRASDVVKELLEARGHDVTVWESTEERIMQLPESERAAA
IANVYAQKQPISNLTDHYDLILNLVDVNSGGTVQRIVWPAAKGTPDQPFYVHEIPTIVVS
VQHAFALADMPQVGTYINAYDGKDNTMKALVEKLAGESNFTGVSPVDAFCGLIDTHLWRE
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaaaagaaatgacacatttagtagatttacgcaaaaaaccttatcatcttgat
gaccaagccatcgcttgggtagaagaaaccattgcctccatgtccttggaggagaaaatt
gggcagttatttgttaacatgggagctagtcgtaccgaagagtatttgacccaagtgctt
aatgattataaaattgcggcggttcgctacaataaaggcatggccgacgaagtttgggaa
caaaactacatcttacaaaccaaatcaaaaattccactcttaattgctgctaacaccgaa
gcaggtggcgatggcgcagttaatgatggcacaaaggttggggacgagattaaggttgcc
gcaacaaatgatccaaagtacgcttacgaaatggggcgcattgcagggattgaagcagca
gcggttggctgtaacgcttcctttgctcctattgttgacctgacacgcaactggcgcaac
ccaattatcgctagccgtaactggggttcaaatgtggaccaaatcattaccttgtctaaa
gagtacatgagagggattatggagcatggcattatgccatttgccaaacatttcccaggg
gacgggattgatgaacgtgaccatcacctctcttttgcatcaaacccgatgacaaaagac
gagtggatgtctaccttcggtcgtatttatggtgaactagctgaagctggtcttcctggt
attatggcaggtcatatccatttgccaaatgttgagaaagagttgcatcctgaacgtgag
ttggatgacatgctaccagcttcactcaacaaaacgttgttggatgaattgctgcgcggg
gagcttggttacaatggggctattgtgacagatgcttctcacatggttgccatgacagct
tctatgccacgtcgtttgatgctgccaacggctgtggaagcgggatgtgacctcttctta
ttctttaatgatccagatgaagacttgcaatggatgaaagaaggctatgaggctggtatt
ttgacagaagaacgactccatgatgcccttcgccgtacgcttggcttgaaagcacgtcta
ggacttcatttatatgaaggtcgtcgtgaagagattatgctaccaaaagaagaagcgatg
acactgattaataccaaagaagcgcaagccattgctgacgaggtagctgacaaagccatt
actcttgttaaagataagcaaaaggatattttcccagtcacgcctgaacgctacaaacgc
attttgattgtcaatgtagaaggtctcaaaggtggttttggtgcgatgattgcagggcag
aaaaaacgagcatccgatgtggtcaaagaattgctagaagcgcgtggtcatgacgtcacg
gtgtgggagtcaacggaagaacgtatcatgcaattgccggaaagcgaacgtgcagcagcc
attgctaatgtttatgcccaaaaacaacccatttccaatttgacagaccattacgattta
atccttaaccttgttgatgtcaactctggtggaacagttcagcgtattgtctggccagca
gccaaggggacaccggatcagccattttatgtgcatgaaatcccaacaattgtggtatca
gttcaacatgcctttgccctagcagacatgccacaagtagggacttatatcaatgcttac
gacggtaaggacaataccatgaaagctttggtggagaaattggctggcgaatccaacttc
accggtgtttcaccagtagatgctttctgtggccttattgacacgcatttgtggcgagag
tactaa

DBGET integrated database retrieval system