KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1272Help
Entry
GGS_1272          CDS       T02269                                 

Definition
glycosyl hydrolase, family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sda00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sda00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1359355..1361160)
Genome map
AA seq 601 aa AA seqDB search
MKGKEMTHLVDLRKKPYHLDDQAIAWVEETIASMSLEEKIGQLFVNMGASRTEEYLTQVL
NDYKIAAVRYNKGMADEVWEQNYILQTKSKIPLLIAANTEAGGDGAVNDGTKVGDEIKVA
ATNDPKYAYEMGRIAGIEAAAVGCNASFAPIVDLTRNWRNPIIASRNWGSNVDQIITLSK
EYMRGIMEHGIMPFAKHFPGDGIDERDHHLSFASNPMTKDEWMSTFGRIYGELAEAGLPG
IMAGHIHLPNVEKELHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVAMTA
SMPRRLMLPTAVEAGCDLFLFFNDPDEDLQWMKEGYEAGILTEERLHDALRRTLGLKARL
GLHLYEGRREEIMLPKEEAMTLINTKEAQAIADEVADKAITLVKDKQKDIFPVTPERYKR
ILIVNVEGLKGGFGAMIAGQKKRASDVVKELLEARGHDVTVWESTEERIMQLPESERAAA
IANVYAQKQPISNLTDHYDLILNLVDVNSGGTVQRIVWPAAKGTPDQPFYVHEIPTIVVS
VQHAFALADMPQVGTYINAYDGKDNTMKALVEKLAGESNFTGVSPVDAFCGLIDTHLWRE
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaaaagaaatgacacatttagtagatttacgcaaaaaaccttatcatcttgat
gaccaagccatcgcttgggtagaagaaaccattgcctccatgtccttggaggagaaaatt
gggcagttatttgttaacatgggagctagtcgtaccgaagagtatttgacccaagtgctt
aatgattataaaattgcggcggttcgctacaataaaggcatggccgacgaagtttgggaa
caaaactacatcttacaaaccaaatcaaaaattccactcttaattgctgctaacaccgaa
gcaggtggcgatggcgcagttaatgatggcacaaaggttggggacgagattaaggttgcc
gcaacaaatgatccaaagtacgcttacgaaatggggcgcattgcagggattgaagcagca
gcggttggctgtaacgcttcctttgctcctattgttgacctgacacgcaactggcgcaac
ccaattatcgctagccgtaactggggttcaaatgtggaccaaatcattaccttgtctaaa
gagtacatgagagggattatggagcatggcattatgccatttgccaaacatttcccaggg
gacgggattgatgaacgtgaccatcacctctcttttgcatcaaacccgatgacaaaagac
gagtggatgtctaccttcggtcgtatttatggtgaactagctgaagctggtcttcctggt
attatggcaggtcatatccatttgccaaatgttgagaaagagttgcatcctgaacgtgag
ttggatgacatgctaccagcttcactcaacaaaacgttgttggatgaattgctgcgcggg
gagcttggttacaatggggctattgtgacagatgcttctcacatggttgccatgacagct
tctatgccacgtcgtttgatgctgccaacggctgtggaagcgggatgtgacctcttctta
ttctttaatgatccagatgaagacttgcaatggatgaaagaaggctatgaggctggtatt
ttgacagaagaacgactccatgatgcccttcgccgtacgcttggcttgaaagcacgtcta
ggacttcatttatatgaaggtcgtcgtgaagagattatgctaccaaaagaagaagcgatg
acactgattaataccaaagaagcgcaagccattgctgacgaggtagctgacaaagccatt
actcttgttaaagataagcaaaaggatattttcccagtcacgcctgaacgctacaaacgc
attttgattgtcaatgtagaaggtctcaaaggtggttttggtgcgatgattgcagggcag
aaaaaacgagcatccgatgtggtcaaagaattgctagaagcgcgtggtcatgacgtcacg
gtgtgggagtcaacggaagaacgtatcatgcaattgccggaaagcgaacgtgcagcagcc
attgctaatgtttatgcccaaaaacaacccatttccaatttgacagaccattacgattta
atccttaaccttgttgatgtcaactctggtggaacagttcagcgtattgtctggccagca
gccaaggggacaccggatcagccattttatgtgcatgaaatcccaacaattgtggtatca
gttcaacatgcctttgccctagcagacatgccacaagtagggacttatatcaatgcttac
gacggtaaggacaataccatgaaagctttggtggagaaattggctggcgaatccaacttc
accggtgtttcaccagtagatgctttctgtggccttattgacacgcatttgtggcgagag
tactaa

DBGET integrated database retrieval system