KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1382Help
Entry
GGS_1382          CDS       T02269                                 

Gene name
glcK
Definition
glucokinase/xylose repressor (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GGS_1382 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GGS_1382 (glcK)
   00052 Galactose metabolism
    GGS_1382 (glcK)
   00500 Starch and sucrose metabolism
    GGS_1382 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    GGS_1382 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GGS_1382 (glcK)
   00524 Butirosin and neomycin biosynthesis
    GGS_1382 (glcK)
Enzymes [BR:sda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GGS_1382 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1489549..1490520)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTVKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLELYGL
SSADFIGIGMGSPGAVDRTANTVTGAFNLNWKETQEVGSIIEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSTIKAAIDNGDNVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagttactggggattgatttaggtggaaccactgttaaatttggtatttta
acagcagcaggagaagtccaagaaaaatgggcgattgagactaatattttagaagggggc
aagcacattgtccctgatatcatcgcttccatcaaacaccgcttggaattatatggtcta
agcagtgcagattttattggtatcggtatggggtcaccaggggctgttgaccgtactgct
aatacagtgaccggagcattcaaccttaactggaaagaaactcaggaagtcggttccatt
attgaaaaagaattaggtattccttttgccattgataatgatgccaatgtggctgctctt
ggtgagcgttgggttggagctggcgaaaacaatcctgatgttgttttcatgacactagga
actggtgtcggtggggggattatcgccgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ctggcagaagcttatgaaggagattctaccattaaagccgccattgataatggggacaat
gtcaccagcaaagatattttcatggccgctgaagcaggagattcctttgcagattctgtt
gtggaaaaggttggttactaccttggtcttgcgtcagcaaatatctcaaatatcttgaat
ccagattcagtggttattggtggaggcgtgtcggcagcaggagaattcttacgttcacgc
attgaaaaatattttgtgaccttcaccttcccacaagtgagatattcaactaaaattaag
attgcagagctgggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacagagtag

DBGET integrated database retrieval system