KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1397Help
Entry
GGS_1397          CDS       T02269                                 

Gene name
rbsK
Definition
ribose transport protein (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GGS_1397 (rbsK)
Enzymes [BR:sda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GGS_1397 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1506115..1507026)
Genome map
AA seq 303 aa AA seqDB search
MSKIVIVGSISMDLVMKTNRIAQEGETVFGDSFAMVPGGKGANQAVAVGRLAAQKDQINM
LGAVGEDSFGHLLLQNLADNGLNVDFVGTVPSSSGIAQITIFNHDNRIIYCPGANGEVDT
TLWEKEWDLLEAADLVILQNEIPHQANLGIAQFCHDKGIKVLYNPAPARETDKEMLDLVT
YFTPNQHEVQELFPDKELDTILEAYPNRLIVTLGTKGSTYFDGQVIQLIPAIKTEAIDTT
GAGDTFNGAFGFAVSKGLDMRESLKFATLASHLSVQQFGAQGGMPTLSEMKEHDAYEKAW
DFE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagattgttattgtcggcagtatctccatggaccttgtgatgaagaccaatcgg
attgcgcaagagggagagacggtttttggagatagctttgctatggttcctggtggtaaa
ggggctaaccaagctgttgcagttggtcgcttagccgcccaaaaagatcagattaacatg
ctgggagctgtgggcgaggattcctttggccatctcttattacaaaatttagcagataac
ggtcttaacgtggactttgtgggaacggtaccatcatcgtctggtattgctcaaatcacc
atttttaaccatgacaaccgaattatctattgtcccggagcgaatggagaggttgacaca
actctttgggaaaaagaatgggatttattagaagcagctgatttggttattcttcaaaat
gaaatcccgcaccaagctaatttgggcatagctcaattttgtcatgataaaggtatcaag
gtgctctataacccagcccctgcgagagagacagataaagagatgctagacttggtcacc
tatttcacaccaaaccaacatgaagttcaagaactcttcccagataaagaattggacact
attcttgaggcatatccaaatcgtcttatcgttactttgggaactaagggatctacttac
tttgatgggcaagttattcaactgattccagccattaagactgaagctattgatacgaca
ggtgctggagatacctttaacggagcctttggttttgctgtttcaaaaggattagacatg
cgtgaatctttaaaatttgcgaccttggcctcacacttatctgttcaacaatttggtgcc
caaggtggcatgccaacattatcagaaatgaaggagcacgacgcttatgaaaaagcatgg
gattttgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system