KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1536Help
Entry
GGS_1536          CDS       T02269                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00072  Synthesis and degradation of ketone bodies
sda00650  Butanoate metabolism
sda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    GGS_1536
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    GGS_1536
Enzymes [BR:sda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     GGS_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Epimerase DUF3783 Methyltransf_25 NAD_binding_2 GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: BAM61658
UniProt: M4YZ85
Position
1658318..1658785
Genome map
AA seq 155 aa AA seqDB search
MTHTKEVAFITGAASGIGKQIGETLLKEGKTVVFSDINQEKLDQVVADYTKEGYDAFSVV
CDVTKEEAINAAIDTVVEKYGRIDILVNNAGLQHVAMIEDFPTEKFEFMIKIMLTAPFIA
IKRAFPTMKAQKHGRIINMASINGVIGFAGKSAYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgacacatactaaagaagttgcatttatcactggtgctgcaagcggaattggaaaacaa
atcggggaaaccttattaaaagaaggtaaaacggttgttttttctgacattaatcaagaa
aaactggatcaggttgttgctgactatactaaagaaggctatgacgcttttagtgttgtg
tgcgatgtcaccaaagaagaagccatcaatgctgctattgatacggttgttgaaaaatat
ggtcgtattgatattttggttaacaacgcaggccttcaacatgttgccatgattgaagac
tttccaactgaaaaatttgagtttatgattaaaatcatgttgacagcaccatttattgct
attaagcgtgccttcccaacaatgaaagctcaaaaacatggacgtatcattaatatggca
tccattaatggtgtcatcggctttgctggaaaatcagcttatttgtag

DBGET integrated database retrieval system