KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1559Help
Entry
GGS_1559          CDS       T02269                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00330  Arginine and proline metabolism
sda00332  Carbapenem biosynthesis
sda01100  Metabolic pathways
sda01130  Biosynthesis of antibiotics
sda01230  Biosynthesis of amino acids
Module
sda_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GGS_1559 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    GGS_1559 (proB)
Enzymes [BR:sda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GGS_1559 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: BAM61680
UniProt: M4YYK0
Position
complement(1685020..1685847)
Genome map
AA seq 275 aa AA seqDB search
MDMMKRQFEDVTRIVIKIGTSSLVLPAGKINLEKIDQLAFVISSLMNKGKEVILVSSGAM
GFGLDILKMEKRPTNLAKQQAVSSVGQVAMMSLYSQIFAHYQTNVSQILLTRDVVVFPES
LANVTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLS
DIDGLFDKNPTIYEDAQLRSHVTVITQEIIASAGGAGSKFGTGGMLSKIQSAQMVFENKG
QMVLMNGANPRDILRVLEGQPLGTWFKQIEEVRHD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttggatatgatgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcact
agttcattagtgctaccagcaggtaaaatcaatttagaaaaaatcgaccaactggctttt
gtgatttcaagtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatg
ggatttggactagatattttgaaaatggaaaaacgtccgaccaatcttgctaaacaacag
gcagtttccagtgttggtcaggtggccatgatgagtctttattcacaaatttttgcacac
taccaaaccaacgtgtcgcaaattttattgacgagagatgttgtagttttcccagaaagt
ctagcgaatgttaccaatgcttttgaaagtctgattagtttgggcattgtgcctattgtt
aatgaaaacgatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataat
gaccgtctatctgctgtcgttgctggtattacaaaagctgatttattaatcatgttgtct
gatattgatggcctttttgataaaaaccctactatttatgaggatgcgcagctacgcagc
catgttacggtcattacgcaagaaatcattgcttcagcaggtggtgcgggcagtaagttt
ggcacaggtgggatgcttagcaaaattcaatctgcccagatggtatttgaaaacaaagga
cagatggtcttgatgaatggagctaatcccagagatattttaagggtgcttgaagggcaa
ccactaggcacatggtttaaacaaatagaagaggtaaggcatgactga

DBGET integrated database retrieval system