KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1568Help
Entry
GGS_1568          CDS       T02269                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sda00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1697242..1698756)
Genome map
AA seq 504 aa AA seqDB search
MSQEKYIMAIDQGTTSSRAIIFNKKGEKISSSQKEFPQIFPQAGWVEHNANQIWNSVQSV
IAGAFIESSIKPEQIDAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPIAEQLKQDG
HTAMIHEKTGLVIDAYFSATKIRWILDHVPGAQERAEKGELLFGTIDTWLVWKLTDGAVH
VTDYSNAARTMLYNIKDLTWDDEILELLNIPKDMLPEVKSNSEIYGKTAAFHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGDEMQLSSNNLLTTIGYGINGKVH
YALEGSIFIAGSAIQWLRDGLKMIETSPESEQLALASTSDDEVYVVPAFTGLGAPYWDSN
ARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQQLRVDGGAAMNNMLM
QFQADILGIDIARAKNLETTALGAAFLAGLAVGYWEDMDALKELNATGQLFKASMNESRK
EKLYKGWKRAVKATQVFTQDDNAE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaaagtacatcatggccattgaccagggaaccactagttcacgggcaatc
attttcaataaaaaaggagaaaagattagcagtagccagaaagagttcccacagattttt
ccacaggcaggttgggtagaacacaatgccaatcagatttggaattctgtccagtctgtg
attgctggtgcttttattgaatccagtatcaagccggaacaaattgatgccattggtatt
actaaccaacgtgagacaactgttgtttgggacaaaaagacaggtcttccgatttataac
gctattgtgtggcagtcacgccaaaccgctccaattgctgagcaactcaaacaagatggt
cacaccgcaatgattcacgaaaaaacaggcttggttattgatgcttacttttctgcaact
aagatccgttggattttagaccatgtgccaggtgctcaagaacgagctgaaaaaggcgag
ttactttttggaaccattgatacttggctggtttggaaattgacagatggtgctgttcat
gtgacggattattccaatgcggctcgtaccatgctctataatattaaagacttaacatgg
gatgatgagattttagagcttttaaatattccaaaagatatgcttccagaggttaaatcc
aattctgaaatttatggcaaaacagctgcctttcatttttatgggggcgaagtgcctatt
tcaggtatggcgggtgaccaacaggcagctttgtttggccaactagcttttgagcctggt
atggtgaaaaacacttatggcacaggttctttcattatcatgaatactggtgatgagatg
cagttatcgagtaataatcttttgaccaccattggttacgggattaatgggaaggttcac
tatgctttagaaggctctatttttattgcaggctctgccattcaatggttgcgagatggt
cttaaaatgattgagacctcaccagagtctgaacagctggcactagcatctaccagtgat
gatgaagtctacgttgtgcctgcctttactggtttaggagctccttactgggattctaat
gcgcgtggatctgtctttgggttgacacgtggtaccagcaaagaagactttgtcaaagca
accttgcaatctatcgcctatcaagtgcgagatgttattgataccatgcaggtggattca
ggtattgacattcaacaactccgcgtggatggcggtgcagccatgaataatatgctcatg
caattccaggctgatattttggggattgatatcgctcgtgctaaaaatttagaaacaaca
gctctaggagcagctttcttggcaggacttgctgtggggtattgggaagatatggatgct
ttgaaagagttaaatgccacaggtcagctcttcaaggctagcatgaatgaatcgcgcaaa
gaaaaattatacaagggttggaaacgcgctgttaaagcaactcaagtgttcacgcaagac
gataacgcagaataa

DBGET integrated database retrieval system