KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1711Help
Entry
GGS_1711          CDS       T02269                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sda00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GGS_1711 (recD)
Enzymes [BR:sda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GGS_1711 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1845256..1847709
Genome map
AA seq 817 aa AA seqDB search
MEHFFTGTVDRIIFENAANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKVKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGNNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFAFQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALLHCLLEESVSRGDTYVQAR
QLLDFAITLLEDARQVECDPAAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIAKNIS
RLLDTPLSQSFSHDTIQTTIQAVQEDFAITYDQVQQEAIAKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLAAISSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVDLADQMRRGILAADFRDKKADRSYFEAQASFIPDMIQ
KIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLMQNLLNPLEGQTEFLFNDTHFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNLIYTAITRSKSKLIMLGEFAAFDYAIKNEG
DKRQTYLVERFQEQSDLASSQPNQELKSKEQTSLFSNTAALEDDSQKSSSQSTNSNPTEN
SQSDNDDFRLTPENYSTIDSMIGLTESDIALFFQKKS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaacacttttttactggtactgttgaccgcattatctttgaaaatgcagctaatttt
tttaaaattctcctccttgccatcgaagacacagatagtgatattgacgactttgaaatc
attatcacagggacgatggctgacattattgaaggagatgactacaccttttggggggaa
ttgacccagcaccctaaatatggacagcaactcaaactaagccgttaccaaaaagtcaaa
cctagttcatctggtttggttaattatttctccagcgaccattttaaggggattggaaag
aaaacagcggagaaaatcattgccctctatggcaataatactattgaccatattttagaa
gacccaagtaaattagaaactatttctggtctgtccaaagctaatcgtcaagcctttgtc
gctaaactgaaattgaattatggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcctttcaagcgtttgagaagtacaaagaagaggctcttgacctt
gttaaagaaaatccctatcaattagtcgaagatctacaaggttttgggtttaagatggca
gatgctctcgctgaaaacttagggattgagagcgactctccaaaacgttttcgtgctgcc
ctcctgcactgcctcttggaagaatccgtcagtcgaggagacacttatgtccaagcacga
caattattagactttgccatcacactccttgaagatgcacgtcaagtagaatgtgaccct
gctgctgtggctgaacaactaagcgagttaatcatagagggcaaaatcaaaaacagtgac
accaaattgtttgatgctagcctttattttgctgaagaggggattgctaagaatatctct
cgtctcttagatacccctttaagtcagtcatttagtcatgataccatccaaacaaccatc
caagccgttcaagaagactttgctatcacttatgaccaggtgcagcaagaagccattgct
aaagccttaaccagcaaggtatttctcctaacaggtggtcccggaacagggaaaacaact
gttattcgaggcattttgcaggcttacgcgaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgggctgcacgtcgtatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggcctcaacggcgacaacgattac
caagccatggaagattatctagactgcgacttgctgattgtcgatgaattttcaatggtg
gatacctggcttgctaaccaattgttagcagcgattagttcaacaactcaagtaattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtagatttggcagaccagatgcgtcgaggaatcttagctgctgactttcgtgac
aaaaaagctgaccgttcttattttgaagcccaagcctctttcatcccggacatgattcaa
aaaattgttctatctgctattaaaagtggcatccctgctgaggaaattcaaattttagcg
cctatgtacaaaggacaggctggcatcaatcatcttaaccaattgatgcaaaacctcctc
aaccctttggaagggcaaacggaatttctgttcaatgatacgcattttcgtaaaggtgat
aaagtcttgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatataccgaatctaagcaagacgaattaatcttagat
tttgacggtagcgaagtcacgtaccctagaaatgaatggctaaaattaaccttagcctat
gccatgagcattcataagtcacaagggagcgagtttcaagtggtgattttacccatcaca
cgccaaagcggccgacttttgcaacgaaatttaatttatactgctatcacccgttctaaa
agtaagttgattatgctaggtgaatttgcagcctttgactatgctattaaaaatgaaggg
gataaacggcaaacttatttggtggaacgcttccaagaacaatccgacttagcctcctct
caacctaaccaagagctaaaatcaaaagagcagacctcccttttttctaatacggcagcc
cttgaggacgactctcaaaaatcttcctctcaatcaacaaactctaaccccactgagaac
tctcagtcagataatgatgattttaggttaacacctgagaattattcgactatcgattcg
atgatagggcttacagagtcagatattgccctctttttccagaaaaaatcctag

DBGET integrated database retrieval system