KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1804Help
Entry
GGS_1804          CDS       T02269                                 

Gene name
hasC
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GGS_1804 (hasC)
   00052 Galactose metabolism
    GGS_1804 (hasC)
   00500 Starch and sucrose metabolism
    GGS_1804 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    GGS_1804 (hasC)
Enzymes [BR:sda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GGS_1804 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1948759..1949661
Genome map
AA seq 300 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAPQG
KAVNGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQAPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYIIKLGKALEKSETK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgccgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagaatacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagaggactgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaagactatgacaagacgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgctcctcaaggc
aaggctgtcaatggcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttgatatt
ttggaaagacaggctcctggagcaggtaacgaagtgcaactcactgatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaattcaaaggtaatcgttacgatgttggg
gataaatttggattcatgaaaacgtctatcgactatgccctagaacacccgcaggtcaaa
gaagacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtgaaactaag
taa

DBGET integrated database retrieval system