KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0126Help
Entry
SDSE_0126         CDS       T02333                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
sdc00900  Terpenoid backbone biosynthesis
sdc01100  Metabolic pathways
sdc01110  Biosynthesis of secondary metabolites
sdc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SDSE_0126 (ipk)
Enzymes [BR:sdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SDSE_0126 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CCI61638
UniProt: K4QC38
Position
97195..98046
Genome map
AA seq 283 aa AA seqDB search
MVTIIERAPAKINLGLDIQGKRSDGYHDLSMVMVSIDLCDYVTVDHLDEDRIVFSSNCPK
MPTNHNNDVYKAAQLMKDRFQIKTGVSLFLEKRIPVCAGMGGGSSDAAATIRALNQLWHL
DLSQKDMIEIGMQIGSDVPYCLVAGCAQVTGKGEVVSQLAGQLSSWVVLVKPEFGISTRT
VFPDINCDTISRVSIANLVAAIEAGDYNGILAEMGNSLEDISIAKRPFIQKIKDKMMQSG
ADIALMTGSGPTVFALCQTEKQANRVVNSLKGFCKEVYKVRTL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaatcattgagagagctcctgcaaaaatcaatttagggctggatattcagggg
aaacgctcagatgggtatcatgatttgtccatggttatggttagtattgacttatgcgac
tatgtgactgttgatcatttggacgaggacaggattgttttttcatccaattgtcctaaa
atgcctactaatcacaacaatgatgtctataaggctgctcagttaatgaaagaccgcttt
cagattaaaacaggagtgtcactttttttagaaaaacgcattccagtttgtgctggcatg
ggtggcggatcgagtgatgcagcagcaaccatcagagccttgaatcaattatggcactta
gacctcagtcagaaagacatgattgaaatagggatgcagattggtagtgatgtcccttat
tgtttagttgcaggatgtgcccaagtgacaggtaaaggggaagtggtcagccaacttgct
ggtcaattatcgtcttgggtggttttggtaaaaccagaatttggcatttcgacacgcaca
gtatttccggatattaattgtgacaccatttcaagagtgtctattgctaatttggttgct
gcgattgaagcgggtgactataatggcatattggctgaaatgggcaattctctggaagat
atttccattgccaagcgtccctttattcaaaaaataaaggacaaaatgatgcaatctggt
gctgacattgccttgatgacaggcagtggacctacggtttttgccctgtgtcaaacagaa
aagcaggctaatcgagtggtcaatagtttaaaagggttttgtaaggaagtttataaggtg
agaactctgtaa

DBGET integrated database retrieval system