KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0400Help
Entry
SDSE_0400         CDS       T02333                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
  KO
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SDSE_0400 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SDSE_0400 (dapE)
Enzymes [BR:sdc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SDSE_0400 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
362539..363912
Genome map
AA seq 457 aa AA seqDB search
MEMSTIEEQLKDCWEHPITKDYLVVLRQLIAHRSIFAQQLGLEETAQFLKEIFSAAGAQV
IVDQSYAAPFVLATFKSPRPDAKTVIFYQHYDTVPADSDQKWSSDPFTLTEREGHLYARG
IDDDKGHIIARLTALVKYLSQAQTLPVTIVFMMEGAEESASVDLEKYLKKYARNLQEADL
LIWEQGIRNEQDQLELTGGNKGILTFDMTVESAKLDIHSKYGGVIDSATWYLLEAIASLR
DRNGRLLVPAIYEQVQEPTKRELDLIEIYAIEQLDDLKKLYGLELPMLQSERRDFLKTYY
YQPSIGIQGIQSGYQGQGVKTIIPSQASAKMEVRLVPGLDPKIVFEQIQTHLLDKGFDKV
NVTYTLGEKSYRSDLSAPAIQQVIDVAKPLYPKGLSLLPTSAGTGPMHTVFEALGVPIVA
FGLGHANSRDHAGDENIAIADYCRHIVLIEELLKSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggagatgtccacaatagaggaacagttaaaagattgttgggagcaccctataaccaaa
gattatctagtcgtgctgcgtcagttaattgctcaccgctctatttttgcacaacaacta
gggcttgaagaaactgctcagtttttaaaagagatttttagtgctgcaggagctcaagtt
attgtggatcagtcctatgcggctccttttgtattagctacctttaagagccctcggcca
gatgccaagacagtcattttttatcagcactatgacacggtacctgctgattctgaccaa
aaatggtctagtgatccctttaccttaacagaacgagaaggtcatttgtatgcaagaggc
atagatgatgataaggggcatattattgctaggttaacagctcttgtgaaatacctttct
caagcacagactctgcctgttaccattgtgtttatgatggaaggcgcagaagaatctgcc
tcagtagacttagaaaaatatctgaaaaagtatgcaaggaacttgcaggaagcagacctc
ttgatttgggaacaaggtattcgcaatgaacaagaccaattggaattaactggcggcaat
aaagggattttaacctttgatatgactgttgagagtgctaagcttgatatccattctaaa
tacggtggggtaattgattcagcaacctggtatttgctagaagctatcgcttctttacga
gataggaatggccgtcttttagtgccagccatttatgagcaggtgcaagaaccaactaaa
cgagaactagatttgattgagatctatgctatcgaacagttggatgatttaaaaaagctt
tacggactagagcttcctatgttacaatcagaacggcgtgattttttgaaaacctattat
taccaaccgtccataggtattcaaggaatacagtcgggttatcagggacagggcgtcaaa
accattattccttcacaggcttccgctaagatggaggttcgtctagtgcctggacttgat
cccaaaatcgtgttcgagcagattcaaactcatttgttggacaaaggttttgataaggtc
aatgtgacctatacgttgggagaaaaaagttatcgtagtgatttgtctgcgccagctatt
caacaagtgatagatgtggcgaagcccctttaccccaaaggattatcccttttaccaacg
tcagctggaacagggcctatgcacactgtctttgaagcacttggggttccaattgtagca
tttgggttgggtcatgctaatagtcgggatcatgcaggcgatgaaaatattgctatcgca
gattactgtcgccatatcgtactaatagaggagttattaaaatcttatgaatga

DBGET integrated database retrieval system