KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0614Help
Entry
SDSE_0614         CDS       T02333                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDSE_0614 (bglA)
Enzymes [BR:sdc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SDSE_0614 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
557325..558749
Genome map
AA seq 474 aa AA seqDB search
MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWTDSPTSDNLTLEAIDF
YHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEVGLQFYDDLFDELLNYGIEPL
VTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDVKVGCMILAMPAYPMTSDP
RDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIVFEDGDKELLAEHTVDFLSF
SYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQIDPIGLRLVLNQYYDRYQIPL
FIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQVAKAIEDGVEVMGYTAWGCIDC
VSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWYRQVIQTNGRYLEDNFS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggaatttttccaaaagatttcttatggggcggcgcagtagctgccaaccaagtggaa
ggagcatttgaggcagacgcaaaaggtttgtccgtacaagatgttctaccaaatggtgga
ctaggagaatggacagatagtcctaccagcgataatttaactttagaggcgattgatttt
taccaccgctacaaagaagacattgctctttttgccgagatgggctttaaagtctttcga
acgtctattgcttggtctcgtatttttccaaatggtgacgatgaccagcccaatgaagta
ggtttgcaattttatgatgacttattcgatgaattgttgaactatggcatcgaaccctta
gtgaccttgtcgcattatgagacacctctgcatttggccaaagcctataatggttggaca
gatagacgtctgattggcttttttgagcgctttgctcagacagtcatggaacgctataag
gacaaagtcaaatactggttgaccttcaacgaagtcaactcgattttacacatgcccttt
accagtggtggcatcatgacagaaaaagaaaagctgagcctgcaagatttataccaagct
attcatcatgaattggtagcatctgctagtgtcacaaagctagcgcatgaaatcaatcct
gatgttaaagttgggtgtatgattttggcgatgcctgcttacccaatgacctctgatcct
cgtgatatacttgctgcgcatgcatttgaaaatcttaatctcttattttcagatattcat
gtgagaggcaagtatccttcatatattaagtcgtattttaaagaaaatgggattgagatt
gtttttgaagacggagacaaggaattattagcggaacatacggttgattttctatccttt
agctattacatgagtgtcacacaagcccacaatcctgaagcttacacatctggtcaggga
aatattctaggtggtttgtccaatccatatttagaatcttcggagtggggttggcagata
gacccaattggtctgcgattggtcttgaatcagtactatgaccgctaccagattcctttg
tttattgttgaaaatggcttaggtgcaaaggatcagctggtgcaaaccgcagatggcagc
atgacggttcacgatgattatcgcattgactacatgagtcagcatctcgtacaagttgcc
aaagcgattgaagatggcgttgaggtcatgggttacactgcttggggctgtattgattgt
gtctctatgtcaacagcccaattaagtaagcgctacggttttatttatgttgaccgaaat
gatgatggtactggtcaactcacacgctataagaaaaaatcgtttgattggtaccgacaa
gtcattcaaaccaatggacgttaccttgaagataatttttcctaa

DBGET integrated database retrieval system