KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0882Help
Entry
SDSE_0882         CDS       T02333                                 

Gene name
dyr
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sdc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sdc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834701..835198
Genome map
AA seq 165 aa AA seqDB search
MTKEMIAIWAEDEAGLIGVDGKLPWYLPRELQHFKETTLNQAILMGRVTFDGMNRRLLPN
RQTLVMTRDVNYQVDGVLTMTSVEEVLDWYHAQEKTLYVIGGSKVLEAFDGYFNRVIKTV
VHHQFEGDTYRPKLDLSRFREESQTFYPKDANNPYDFTVTVLKHQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaatgattgctatctgggcagaagatgaagcaggtcttatcggggttgat
ggcaagctaccatggtacctgccaagagagctgcaacattttaaagaaacaactttgaat
caagctattttaatggggagagtaacctttgatggcatgaatcgtaggctgcttcctaat
cgtcaaacccttgtgatgacaagagatgtaaactatcaagtagatggggtattgaccatg
actagtgttgaggaagtgctggattggtatcatgcacaggaaaaaacactttacgttatt
ggtggaagcaaggttttagaagcctttgacggttattttaatcgtgtgattaaaacagtg
gttcatcaccaatttgaaggggatacctaccgaccaaaacttgacttaagtcgttttagg
gaagaaagccaaaccttctatccaaaggatgcaaacaatccttacgattttacagtgacg
gttttaaaacaccaatag

DBGET integrated database retrieval system