KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0900Help
Entry
SDSE_0900         CDS       T02333                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SDSE_0900 (folK)
Enzymes [BR:sdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SDSE_0900 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851706..852206
Genome map
AA seq 166 aa AA seqDB search
MTIVYLSLGTNMGDREEYLSQAVQSLAKIPNTHLLAQSSIYETAAWGKTDQADFLNMACQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGPRTIDIDILLFGEEVYDTKELKVPHPYMTE
RAFVLLPLLELNADLKLPVRQVPLSVDLAALDTSDITLFSARQTES
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttagggaccaatatgggagaccgagaagagtacttgagt
caagctgttcagtcccttgctaagattcctaacacccatttactagctcaatcgtctatt
tatgaaacggctgcttggggtaagacagatcaagctgacttccttaacatggcctgtcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggaccaagaaccattgacattgatatcttgcta
tttggagaagaggtttatgacacaaaggaattgaaagtgccacacccatatatgactgag
cgtgcttttgttttgcttcctttattagaattaaacgctgatttgaagctgcccgtccgt
caagtccctttatcggttgatttggcggctttagacacctcagacatcacgcttttttca
gctcgacagacagagtcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system