KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_1131Help
Entry
SDSE_1131         CDS       T02333                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
sdc00010  Glycolysis / Gluconeogenesis
sdc00030  Pentose phosphate pathway
sdc00051  Fructose and mannose metabolism
sdc00052  Galactose metabolism
sdc00680  Methane metabolism
sdc01100  Metabolic pathways
sdc01110  Biosynthesis of secondary metabolites
sdc01120  Microbial metabolism in diverse environments
sdc01130  Biosynthesis of antibiotics
sdc01200  Carbon metabolism
sdc01230  Biosynthesis of amino acids
sdc03018  RNA degradation
Module
sdc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDSE_1131 (pfkA)
   00030 Pentose phosphate pathway
    SDSE_1131 (pfkA)
   00051 Fructose and mannose metabolism
    SDSE_1131 (pfkA)
   00052 Galactose metabolism
    SDSE_1131 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SDSE_1131 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SDSE_1131 (pfkA)
Enzymes [BR:sdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SDSE_1131 (pfkA)
Protein phosphatases and associated proteins [BR:sdc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SDSE_1131 (pfkA)
Messenger RNA biogenesis [BR:sdc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SDSE_1131 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CCI62628
UniProt: K4QCP3
Position
complement(1065691..1066704)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVVSTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggtgacgctcctggtatgaatgctgctatt
cgtgcagtcgttcgtaaagcaatctcagaaggaatggaagtttatggtattaaccgtggc
tacgcaggcatggttgacggtgatattttcccattaggttcaaaagaagtgggagataaa
atttcacgtggtgggactttcttatactcagctcgttatccagagtttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgaaggtgttgttgttatc
ggtggagatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagccac
ggacgtacttttgtggttgaagtgatgggtcgcaatgcgggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggtatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacatcatcgtc
ttagctgaaggtgttatgagtggtgaagcttttgctcaaaaacttaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggccacattcttcgtgggggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagaaggc
aaaggtggcttggctgttggtattcataatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaaccgttcattgtcacaataa

DBGET integrated database retrieval system