KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_1131Help
Entry
SDSE_1131         CDS       T02333                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDSE_1131 (pfkA)
   01230 Biosynthesis of amino acids
    SDSE_1131 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDSE_1131 (pfkA)
   00030 Pentose phosphate pathway
    SDSE_1131 (pfkA)
   00051 Fructose and mannose metabolism
    SDSE_1131 (pfkA)
   00052 Galactose metabolism
    SDSE_1131 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SDSE_1131 (pfkA)
Enzymes [BR:sdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SDSE_1131 (pfkA)
Protein phosphatases and associated proteins [BR:sdc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SDSE_1131 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1065691..1066704)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVVSTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggtgacgctcctggtatgaatgctgctatt
cgtgcagtcgttcgtaaagcaatctcagaaggaatggaagtttatggtattaaccgtggc
tacgcaggcatggttgacggtgatattttcccattaggttcaaaagaagtgggagataaa
atttcacgtggtgggactttcttatactcagctcgttatccagagtttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgaaggtgttgttgttatc
ggtggagatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagccac
ggacgtacttttgtggttgaagtgatgggtcgcaatgcgggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggtatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacatcatcgtc
ttagctgaaggtgttatgagtggtgaagcttttgctcaaaaacttaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggccacattcttcgtgggggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagaaggc
aaaggtggcttggctgttggtattcataatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaaccgttcattgtcacaataa

DBGET integrated database retrieval system