KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_1224Help
Entry
SDSE_1224         CDS       T02333                                 

Gene name
acoC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
sdc00010  Glycolysis / Gluconeogenesis
sdc00020  Citrate cycle (TCA cycle)
sdc00620  Pyruvate metabolism
sdc01100  Metabolic pathways
sdc01110  Biosynthesis of secondary metabolites
sdc01120  Microbial metabolism in diverse environments
sdc01130  Biosynthesis of antibiotics
sdc01200  Carbon metabolism
Module
sdc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDSE_1224 (acoC)
   00020 Citrate cycle (TCA cycle)
    SDSE_1224 (acoC)
   00620 Pyruvate metabolism
    SDSE_1224 (acoC)
Enzymes [BR:sdc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SDSE_1224 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B
Motif
Other DBs
NCBI-ProteinID: CCI62718
UniProt: K4QCR7
Position
complement(1153248..1154657)
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDVLLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPTVAPKEDVASPAPQV
AATAIPQGNGGKVRATPAARKVAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVELPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINNANDIELHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctcggcgttgacatgcaagagggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatgtccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgttctattgaaaattgtt
cgtccagctggtgatactgtacctgtaactgaagttatcggttacattggtgcagaaggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagatgcaggaccaacagtagctccaaaagaagatgtggccagtccagctcctcaggta
gcagcgacagctattccgcaaggaaatggtggaaaagttcgtgctactccagctgcacgt
aaggttgcagcagaaatgggcattgaccttggtcaagttccaggaacaggaccaaaaggg
cgtgtccataaagaagatgttgagaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaatcgctgctgataaaggtatcgacttggcgactgtttcaggtactggcttt
aacggtaaggtcatgaaagaagacatcatggctattcttgaagctgctaaaccagctgaa
gcaaaagcaccagcagctaaagaagaaaaagttgttgagcttccagagggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gcgcctacctttacgcttaactacgatattgatatgacagaaatgatcgcccttcgtaag
aagttaattgacccaatcatggctaaaacaggccttaaagtcagcttcacagacttgatt
ggtatggcagtggttaaaacgttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaataacgctaatgatattgaattgcaccgctttgtgaacctgggtattgccgtaggt
cttgatgatggtcttattgttccagttatccatggtgcagataagatgagcttgtcagat
ttcgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaagcagct
gaaatgtctggatcaaccttctcaatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgtccaattatggcgatgtgcttaaccatc
gaccatcgcttggtagacggtatgaacggtgcaaaattcatggttgacctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system