KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_1268Help
Entry
SDSE_1268         CDS       T02333                                 

Gene name
gst
Definition
glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sdc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1194581..1195189)
Genome map
AA seq 202 aa AA seqDB search
MKLYYAPGTCALACWIAMEWAQLDYEVEKVKLGSEEYLNINPLGMVPALQLDDGQIITQA
GTILIFIAKQAPRAQIIPQDNLLAESRFNEIMDFLTGDFHPAFWPMFSPHRYTISQENQA
LEEVKQASYKRIDIAMTHLDGLIGDSGHVYHDQRTIADAYAYVMALWSQKTPKSYENYPH
LAAFMAKMAEDAAVKKVTAAAH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttattatgctcctggaacctgtgccttagcttgctggatagctatggaatgg
gcacaattggattacgaggtagagaaggtaaaactgggttctgaagaataccttaacatc
aatcctttggggatggtgccagctttacagcttgatgatggtcaaattatcacacaggca
ggtaccatcttgatctttatagcgaaacaagctccgagagctcagatcattccccaagac
aatcttttggcagaaagtcgattcaacgaaatcatggacttcttaacaggtgattttcac
cctgctttttggccaatgtttagccctcatcgctacactatttctcaagagaatcaagcg
cttgaagaagtcaaacaagcttcttacaaacggattgatattgctatgacgcatttagat
ggtcttattggagatagtgggcatgtttatcacgatcagagaactattgcagatgcttat
gcttatgtcatggccttatggtcgcaaaaaacacctaaatcatatgaaaattacccacat
ttagctgcttttatggcaaaaatggcagaggatgcagctgttaagaaagtgactgctgcg
gctcactaa

DBGET integrated database retrieval system