KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_1275Help
Entry
SDSE_1275         CDS       T02333                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SDSE_1275 (malM)
Enzymes [BR:sdc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SDSE_1275 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1200606..1202102)
Genome map
AA seq 498 aa AA seqDB search
MNKRASGILMHISSLPGKTGIGTFGKAAFDFVDFLKETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHFIDLELLVADGYLQEADLVGVDFGSDPEVVDYAQIFQARRPLLEKAVQAFL
ATKEAVKELAAFEAEASWLGDFAEFMSLKEHFQNKALQEWDDSAIVKREEAALHHYRELL
AESIHYHKVCQYFFYQQWLALKAYANDNGIEIIGDMPIYVSADSVEVWTMPDLFKVDEDK
NPLFIAGVPADGFSEDGQLWGNPIYNWAAHEASNFAWWIYRIQESFKLYDYLRIDHFKGF
SDFWEIPGGDTTARNGHWESAPGLALFAAVREALGELPIIAENLGYIDEKAEQLLASTAF
PGMKILEFGLFDITSQSSDLPHHYDRNCVVYTGTHDNEVVNGWYANLTEEQVTFVNDYLH
KGADESITQAMLRTIFATVSDTAILCMQDLLDKGAESRMNMPNTVGGNWQWRMLEGDITE
EHKAYLTHLTELYDRVNH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacgtgcaagcggtatcttaatgcatattagttcccttcctggtaagaccgga
attggaactttcgggaaggcagcttttgactttgttgatttcctaaaagaaaccaaacaa
acttattggcagattctacctttaacaacgacaagttatggggattcaccttaccaatca
ttttcagctattgcaggtaatactcattttatcgatcttgaattacttgttgcagacggc
tacttgcaggaagctgatctcgttggcgttgattttggttctgaccctgaggtggttgac
tatgctcagatttttcaggcaagacgccccttattagaaaaagcggtccaagcttttctt
gcaactaaagaagccgtcaaagaattggcagcttttgaagcagaagcgagttggttgggt
gactttgccgagttcatgtcattgaaagaacactttcaaaataaggccctacaagaatgg
gatgacagtgcaattgtgaaacgcgaagaagcagccttgcatcattaccgtgaattactt
gctgaaagtattcactaccataaagtctgtcaatatttcttctaccaacaatggttggcc
ttaaaagcgtatgccaatgataatggcattgagattattggtgatatgccaatctatgtt
tctgcagatagtgtggaagtttggacaatgccagacttgtttaaagtggacgaggataaa
aacccactctttatcgctggagttcctgcagatggctttagtgaagatggtcaactttgg
ggcaatccgatttacaattgggcagcccatgaagcatccaactttgcttggtggatttac
cgtattcaagaaagtttcaaattatatgactatttgagaattgatcactttaaaggcttt
tcagatttctgggaaattcctggtggcgacacaactgctcgaaatggacattgggaatca
gctccgggacttgctttgtttgcggcagttcgtgaggctttaggagaactgcctatcatc
gcagaaaaccttggttatattgatgaaaaggcagagcagctattagcctcaacagccttt
ccaggaatgaagattttagaatttggcctttttgacattaccagccaaagcagtgattta
ccacatcattatgatcgtaactgtgtggtttatactggtacgcatgataacgaagtggtt
aatggttggtatgcaaaccttacggaagaacaagttacttttgtgaatgactacctccac
aaaggtgcagatgaaagtattacacaagccatgttgcgcacgatttttgcaacagttagt
gatacggctatcttgtgcatgcaagacttgcttgataagggggcagaaagccgcatgaac
atgccaaataccgtgggtggcaattggcaatggcggatgcttgaaggagatatcaccgaa
gagcacaaagcctacttgacacatttgacagaattatacgatcgcgtcaatcattaa

DBGET integrated database retrieval system