KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_1572Help
Entry
SDSE_1572         CDS       T02333                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SDSE_1572 (recR)
DNA repair and recombination proteins [BR:sdc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SDSE_1572 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1488242..1488838)
Genome map
AA seq 198 aa AA seqDB search
MFYPTPIAKLIESYSKLPGIGVKTATRLAFYTIGMSDEAVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCSICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMDGKVTEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgttttacccaacccctattgcaaaattaatcgaaagttattccaagctcccaggaatt
ggggtaaaaacggcaactagacttgccttttacacaattggaatgtctgacgaggctgtc
aatgactttgctaaaaatttattggcagctaaaagagaattaacctattgttccatttgt
ggcaacctgacagatgatgatccttgttctatctgcacagatacaagtcgtgaccagaca
acgattcttgtggtggaagatgctaaagatgtttctgctatggaaaaaattcaagagtat
catggttattaccatgtgctgcatggtttaatttcaccgatgaatggtgttggtccggat
gatatcaatctaaaaagtttaattacccgtttaatggacggtaaagtgactgaagttatc
gtagcgaccaatgccacagctgatggcgaagcaacatctatgtatatctcacgggtcttg
aaaccagcaggaatcaaagttacccgcttagcaagagggctcgcagtggggtcagatatt
gaatacgcagatgaagtcaccttgttaagagctattgaaaaccgcacagaactttaa

DBGET integrated database retrieval system