KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_2058Help
Entry
SDSE_2058         CDS       T02333                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SDSE_2058 (gltX)
Enzymes [BR:sdc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SDSE_2058 (gltX)
Amino acid related enzymes [BR:sdc01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SDSE_2058 (gltX)
Transfer RNA biogenesis [BR:sdc03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SDSE_2058 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1965669..1967117)
Genome map
AA seq 482 aa AA seqDB search
MSTKPIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFIIRIEDTDRKRHVEDGERSQ
LENLKWLGMDWDESPETHEQYRQSERLDLYQKYIDQLLAEGKAYKSYVTEDELAAERERQ
EAAGETPRYINEFLGMTEEQKAAYIAEREAAGIVPTVRLAVNEAGIYKWTDMVKGDIEFE
GGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAP
AFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEEEIFS
REQLIDLFDENRLSKSPAAFDQKKMDWMSNEYLKNADFETVYALCKPFLEEAGRLTEKAE
KLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAGETVPTVLQAFKEKLEAMSDE
DFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGRDKSIEHINK
ML
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaaaccaattcgtgtgcgttacgcaccaagtccaacgggattactacacatc
ggaaatgcgcggacagcgctctttaactacctttatgcacgtcatcatggcggtacgttt
atcattcggattgaagataccgaccgtaaacgtcacgtggaagacggtgaacgttcgcaa
ttagaaaacttaaaatggcttggtatggactgggatgaaagcccagaaacccatgagcaa
taccgccagtcagaacgtctagatctctaccaaaaatacattgatcaactattggcagaa
ggcaaggcctacaagtcttacgtgactgaagatgaattggcagccgagcgtgagcgccaa
gaagcagcaggtgagacaccacgctatatcaatgaatttcttggcatgacagaagagcaa
aaagcagcttacattgccgagcgtgaagcggcaggaattgttccaaccgttcgtttagct
gttaatgaagctggtatttacaaatggacggacatggttaaaggcgatattgagtttgaa
ggtggcaatatcggtggtgactgggttattcagaaaaaagatggttacccaacttacaac
tttgcggttgttgtagatgaccatgacatgcaaatttcacatgttatccgtggggatgac
catatagccaatacgccaaaacaattgatggtgtatgaagccctaggttgggaagcacca
gcctttggtcacatgacccttatcatcaattctgaaacagggaaaaaattatccaaacgc
gacaccaatactctccaatttatcgaagattaccgcaaaaaaggctatatgcctgaagct
gtctttaactttattgcacttttgggttggaatcctggcggagaagaggaaatcttctct
cgtgagcagttaattgacctttttgatgaaaatcgcctcagcaagtcgccagctgccttt
gatcagaagaaaatggattggatgagcaatgagtacttgaaaaatgcggattttgaaaca
gtttatgccctctgcaaacctttccttgaagaagcaggccgtttgactgaaaaagctgag
aagctagtagaattatacaaaccacagttaaaatctgcagatgagattattccactgacc
gatcttttcttctcagacttcccagaattgacagaagctgaaaaagaagtcatggcaggt
gaaactgttccgacagtcttgcaagctttcaaggaaaaattggaagctatgtcagatgaa
gacttcaaaccagaaaacattttcccacaaattaaggctgttcaaaaagaaacaggaatc
aagggtaaaaacctctttatgccaatccgtattgctgtttctggtgaaatgcatggccct
gaattaccaaatacaatctatttgctaggtcgtgacaaatctatcgaacatattaacaag
atgctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system