KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_2071Help
Entry
SDSE_2071         CDS       T02333                                 

Gene name
hasC
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SDSE_2071 (hasC)
   00052 Galactose metabolism
    SDSE_2071 (hasC)
   00500 Starch and sucrose metabolism
    SDSE_2071 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    SDSE_2071 (hasC)
Enzymes [BR:sdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SDSE_2071 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1979597..1980499
Genome map
AA seq 300 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAPQG
KAVNGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQAPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYIIKLGKALEKSETK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgccgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagaatacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagaggactgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaagactatgacaagacgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgctcctcaaggc
aaggctgtcaatggcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttgatatt
ttggaaagacaggctcctggagcaggtaacgaagtgcaactcactgatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaattcaaaggtaatcgttacgatgttggg
gataaatttggattcatgaaaacgtctatcgactatgccctagaacacccgcaggtcaaa
gaggacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtgaaactaag
taa

DBGET integrated database retrieval system