KEGG   Saccharophagus degradans: Sde_0078Help
Entry
Sde_0078          CDS       T00335                                 

Definition
GGDEF domain
Orthology
K13590  
diguanylate cyclase
Organism
sde  Saccharophagus degradans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
99134..100831
Genome map
AA seq 565 aa AA seqDB search
MTGISGYKEKYLAALDEQEKLERKHALQLDLLRKTIVHLSVAAKGQESKLDASLIALQNK
MRGGSGADVFEQMERVQRAVGEFDREREQELQRVLDWFKSAVDNLMELSVPADLRSQLSL
YKKGLKSQLTSYRAFGEAVNELSALQKRALAAAANPNKGLWQRIKGGKTLEDNAPAKPSR
TSAEPVEAPVERDLGPKESVTKTPPITQVDDPAAEDSYPKVAQRINATLKALVTSIEPND
MVRRKVEIVRDRIDRGMDWFALAVTLEDIRDILMARYLAADKAFSEYLLNINRELVSISE
ALGVAEDAEQQRGGAAEALTASVSKSVKQLQADVAKSNSLPDLQSTVSDHIRTIQNALST
FKQAQPAPSQSLSAQLKALMDRVKTVEEESEKSRAQLEEQRYKATHDPLTSLPNREAYNE
RAFHELHRFKRYGHPLTLAVCDLDHFKKINDTFGHQAGDKVLKLVAQVVSTRLRNVDFVA
RYGGEEFVLVMPETDAEQAKTVLDKMRAAIAKTPFRFKDSPVTITMSFGIVQFRGEDSVE
SAFARADKALYEAKANGRNQCVIAP
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgactggaataagcgggtacaaagaaaaatacctcgccgctttagacgagcaggaaaag
ctcgagcgcaaacacgcactgcaattagacttgttgcgtaaaaccattgtgcacttaagt
gtggctgctaaggggcaggagtccaaattagacgcatcccttattgcgctgcaaaacaaa
atgcgcggcggcagtggtgcagatgtgtttgagcagatggagcgagtgcagcgggcagtg
ggtgagtttgatcgcgagcgcgagcaagagttacagcgggtgctagattggtttaagtcg
gctgtggataacttaatggaattaagtgtgcccgccgatttgcgcagccagttgtcgctg
tacaaaaagggcctaaaatcgcagttaaccagttatcgtgcatttggcgaagcggtaaac
gaactaagtgcattgcaaaagcgggctctagcagcggcagccaacccaaataaggggttg
tggcagcgtattaagggtggcaaaaccctagaagataacgcgccagccaagcccagccgc
acctcagccgagcctgtcgaagcgccagtcgaacgtgatttggggccgaaagagtcggta
acaaagaccccgcccattacgcaagtcgatgatcccgccgcagaagattcctaccccaaa
gtagcccagcgcattaacgccacactaaaggcattagttaccagtatcgagcccaacgat
atggtgcgcagaaaagtcgagattgtgcgcgaccgtatagaccggggtatggattggttt
gcgctggccgtaaccctagaagatattcgcgatatattaatggcgcgctacttggcggca
gataaagcgtttagcgaatacttgctgaatataaaccgcgagctggtatctataagcgag
gcgctgggtgtagcagaagatgcagagcaacagcgcggtggtgcggccgaagcgcttacg
gcgagcgtgagcaaatctgttaagcagctgcaggcggatgttgcgaaatccaatagcctg
ccagatctgcaatcgacggttagcgaccatattcgtactattcaaaatgcgctttccacc
tttaagcaggcgcagccggcgcccagtcaaagtttgtcggcccagcttaaggcgctcatg
gatagggtgaaaacagtagaagaggaatcggaaaaatcccgcgcgcaattggaagagcag
cgctataaagccacccacgaccccctaacaagcctgcccaatcgcgaagcctataacgaa
cgcgcctttcacgagctgcacaggtttaagcgctatggccaccctttaacactggccgtg
tgcgatttagatcactttaaaaaaattaacgatacctttggccatcaagcgggggacaaa
gtattaaagctagttgctcaagtggtatctacacgcttgcgcaatgtagattttgtggcc
cgctacggcggcgaagagtttgtgttagttatgccagaaactgatgccgagcaggctaaa
actgtgctggataaaatgcgagctgccattgcgaaaacgccatttcggtttaaagatagc
ccggtaactatcactatgtcattcggcatagtacagtttcggggtgaggatagcgtcgag
tctgcctttgcgcgcgcagacaaagccttatacgaggcgaaggcaaatggccgcaatcaa
tgtgttattgcaccttaa

DBGET integrated database retrieval system