KEGG   Saccharophagus degradans: Sde_0078Help
Entry
Sde_0078          CDS       T00335                                 

Definition
(GenBank) GGDEF domain
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sde  Saccharophagus degradans
Brite
Enzymes [BR:sde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sde_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
99134..100831
Genome map
AA seq 565 aa AA seqDB search
MTGISGYKEKYLAALDEQEKLERKHALQLDLLRKTIVHLSVAAKGQESKLDASLIALQNK
MRGGSGADVFEQMERVQRAVGEFDREREQELQRVLDWFKSAVDNLMELSVPADLRSQLSL
YKKGLKSQLTSYRAFGEAVNELSALQKRALAAAANPNKGLWQRIKGGKTLEDNAPAKPSR
TSAEPVEAPVERDLGPKESVTKTPPITQVDDPAAEDSYPKVAQRINATLKALVTSIEPND
MVRRKVEIVRDRIDRGMDWFALAVTLEDIRDILMARYLAADKAFSEYLLNINRELVSISE
ALGVAEDAEQQRGGAAEALTASVSKSVKQLQADVAKSNSLPDLQSTVSDHIRTIQNALST
FKQAQPAPSQSLSAQLKALMDRVKTVEEESEKSRAQLEEQRYKATHDPLTSLPNREAYNE
RAFHELHRFKRYGHPLTLAVCDLDHFKKINDTFGHQAGDKVLKLVAQVVSTRLRNVDFVA
RYGGEEFVLVMPETDAEQAKTVLDKMRAAIAKTPFRFKDSPVTITMSFGIVQFRGEDSVE
SAFARADKALYEAKANGRNQCVIAP
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgactggaataagcgggtacaaagaaaaatacctcgccgctttagacgagcaggaaaag
ctcgagcgcaaacacgcactgcaattagacttgttgcgtaaaaccattgtgcacttaagt
gtggctgctaaggggcaggagtccaaattagacgcatcccttattgcgctgcaaaacaaa
atgcgcggcggcagtggtgcagatgtgtttgagcagatggagcgagtgcagcgggcagtg
ggtgagtttgatcgcgagcgcgagcaagagttacagcgggtgctagattggtttaagtcg
gctgtggataacttaatggaattaagtgtgcccgccgatttgcgcagccagttgtcgctg
tacaaaaagggcctaaaatcgcagttaaccagttatcgtgcatttggcgaagcggtaaac
gaactaagtgcattgcaaaagcgggctctagcagcggcagccaacccaaataaggggttg
tggcagcgtattaagggtggcaaaaccctagaagataacgcgccagccaagcccagccgc
acctcagccgagcctgtcgaagcgccagtcgaacgtgatttggggccgaaagagtcggta
acaaagaccccgcccattacgcaagtcgatgatcccgccgcagaagattcctaccccaaa
gtagcccagcgcattaacgccacactaaaggcattagttaccagtatcgagcccaacgat
atggtgcgcagaaaagtcgagattgtgcgcgaccgtatagaccggggtatggattggttt
gcgctggccgtaaccctagaagatattcgcgatatattaatggcgcgctacttggcggca
gataaagcgtttagcgaatacttgctgaatataaaccgcgagctggtatctataagcgag
gcgctgggtgtagcagaagatgcagagcaacagcgcggtggtgcggccgaagcgcttacg
gcgagcgtgagcaaatctgttaagcagctgcaggcggatgttgcgaaatccaatagcctg
ccagatctgcaatcgacggttagcgaccatattcgtactattcaaaatgcgctttccacc
tttaagcaggcgcagccggcgcccagtcaaagtttgtcggcccagcttaaggcgctcatg
gatagggtgaaaacagtagaagaggaatcggaaaaatcccgcgcgcaattggaagagcag
cgctataaagccacccacgaccccctaacaagcctgcccaatcgcgaagcctataacgaa
cgcgcctttcacgagctgcacaggtttaagcgctatggccaccctttaacactggccgtg
tgcgatttagatcactttaaaaaaattaacgatacctttggccatcaagcgggggacaaa
gtattaaagctagttgctcaagtggtatctacacgcttgcgcaatgtagattttgtggcc
cgctacggcggcgaagagtttgtgttagttatgccagaaactgatgccgagcaggctaaa
actgtgctggataaaatgcgagctgccattgcgaaaacgccatttcggtttaaagatagc
ccggtaactatcactatgtcattcggcatagtacagtttcggggtgaggatagcgtcgag
tctgcctttgcgcgcgcagacaaagccttatacgaggcgaaggcaaatggccgcaatcaa
tgtgttattgcaccttaa

DBGET integrated database retrieval system