KEGG   Saccharophagus degradans: Sde_0754Help
Entry
Sde_0754          CDS       T00335                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sde  Saccharophagus degradans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sde01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sde00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
973746..974543
Genome map
AA seq 265 aa AA seqDB search
MTDTPTVLKKIIARKWEEIAERKAVVSAELLREQALAQPACRGFVASIESRLSKGESAVI
AEIKKASPSKGVIREDFNPAELARSYEQGGAACLSVLTDVDFFQGADAYLQQARAAVSLP
VIRKDFIVDSYQLLEARAMGADCVLLIVSALSFEKLLELNEQALALGLDVLVEVHDAVEL
EQALQLPNKLVGINNRNLHTFDVTLQTTFDLLPAIPSDKVVVTESGIFTGEDVASMREQG
VNTFLVGESFMRADEPGEKLRELFF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacagatacacccacggtattaaagaaaattattgcgcgtaaatgggaagaaattgcc
gagcgcaaagcggtggtgtctgccgagctgttgcgcgaacaagcgctggctcagcctgct
tgtcgcggctttgttgcgtcgattgaatcgcgtttgagtaaaggcgagtcggcggtgatt
gctgaaattaaaaaggcgtcgcccagcaaaggggtgattcgcgaagattttaaccctgcg
gaattggcgcgcagctacgagcagggcggtgcggcctgtttgtcggttttaaccgatgtg
gacttctttcagggggcggatgcctacctgcagcaagcgcgtgcagcggtttctctaccg
gttattcgcaaagactttattgtggatagctatcagctgctcgaagcgcgtgccatgggc
gcagattgcgtgttgctgatagtgtcggcccttagctttgaaaagctactagagctaaat
gagcaagcgttggcgctgggtttggatgttttggtggaagtgcacgacgcggtggaatta
gagcaagcgctgcaactacctaacaagttagtgggcattaacaaccgcaacctgcacacc
tttgatgttaccttgcaaactacgttcgatttgttgccagccatcccaagcgataaggta
gtggtaacagaaagcggtatatttaccggagaggatgttgcatctatgcgcgagcagggt
gtgaacaccttcttagtgggggagtcttttatgcgcgcagacgaacctggtgaaaagttg
cgagaactgttcttttaa

DBGET integrated database retrieval system