KEGG   Saccharophagus degradans: Sde_0935Help
Entry
Sde_0935          CDS       T00335                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sde  Saccharophagus degradans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sde_0935
   01230 Biosynthesis of amino acids
    Sde_0935
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_0935
   00030 Pentose phosphate pathway
    Sde_0935
   00051 Fructose and mannose metabolism
    Sde_0935
   00052 Galactose metabolism
    Sde_0935
  Energy metabolism
   00680 Methane metabolism
    Sde_0935
Enzymes [BR:sde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sde_0935
Protein phosphatases and associated proteins [BR:sde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sde_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1208089..1209378
Genome map
AA seq 429 aa AA seqDB search
MSFPLSSSSFSDKKNAFYAQSGGAAAVLNASAAGVVAGVMAHKDKIENLYIGRNGILGAL
HEDMVVVNTHDDNLIDDLLHAPAGAFGSCRYKLKSIEESEREYARILEVFKAHNIGYFFY
NGGGNSQDTSCKLAKYAAKKNYPLQCIGIPKTIDNDLSGTDCSPGYGSVAKYVAVSILEA
SMDLASMHQTSTKVFVMEVMGRDSGWIAAAAGLAADERNLGPDLIIFPEVPYEEYKFYAE
LNRIVARKGFCVVVVAEGVRGPDGNHLTSTANKDAFGHTQLGGAASIIAGRIREVTGHKT
HFAVCDYLQRAARHIASKTDVDQSFLVGKKAVEFAANGYSNVMMAIVRESEQPYRWSVGT
VPLVEAANSRNALPAGFISKCGFHITDACRRYLAPLIAGESYPSYQNGLPAYRVFNSVAV
PKKLEEFTL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccctctttctagcagttctttctcagataaaaaaaatgcattttatgcgcaa
tccggcggtgctgctgctgtactcaatgcttctgctgcaggtgttgttgctggggtaatg
gcccataaagataaaatcgaaaatctgtatattggtcgcaacggtattttgggggcattg
cacgaagatatggtggtggtgaatactcacgatgataatttaatagacgatttactccac
gcccctgcgggagcatttggctcctgtcgttacaaattaaaaagtattgaagaaagcgaa
cgtgagtacgcgcgtattctcgaggtatttaaagcacacaatattggctatttcttttat
aacggcggcggtaattcccaagacacctcttgcaagttagccaagtatgcggctaaaaaa
aattatcctctacagtgtattggtattcccaaaaccattgacaatgatttatccggcacc
gattgtagccctggctacggctcagtagctaaatacgttgccgtttcaatattagaagcg
tcgatggatttagcatctatgcatcaaacttcgactaaagtatttgttatggaagtgatg
gggcgagattctggctggattgccgcagcagcgggtttagcggcagatgagcgaaactta
gggccagatttaattatattccccgaggtgccctacgaagaatataaattctatgccgaa
ttaaatcgcattgttgcacgcaaaggtttttgcgtggtggtggtggcagaaggcgtgcga
ggcccagatggcaaccatcttacatcgaccgccaataaagatgcatttgggcacactcaa
ttaggcggtgctgcatctattattgccggtcgtatacgcgaagtaacaggccataaaaca
cattttgctgtgtgcgattacctacagcgtgctgcgcgacacatcgcctctaaaaccgat
gtggatcaatcctttttggttggcaaaaaggccgtagagtttgccgcaaatggttattcc
aatgtgatgatggcaatagtgcgagaatcagagcagccttataggtggtctgttggcact
gtgccgctggttgaggcggctaattctcgcaatgcgttacccgcaggattcatttctaaa
tgtggctttcacattacagatgcgtgtcgtcggtatttggcccctttaattgccggtgaa
agttatcctagttaccagaatgggttgcccgcttatcgagtatttaactctgtggcagtg
cctaaaaaattagaagagtttacgctttaa

DBGET integrated database retrieval system