KEGG   Saccharophagus degradans: Sde_0935Help
Entry
Sde_0935          CDS       T00335                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sde  Saccharophagus degradans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_0935
   00030 Pentose phosphate pathway
    Sde_0935
   00051 Fructose and mannose metabolism
    Sde_0935
   00052 Galactose metabolism
    Sde_0935
  Energy metabolism
   00680 Methane metabolism
    Sde_0935
Enzymes [BR:sde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sde_0935
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Sde_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1208089..1209378
Genome map
AA seq 429 aa AA seqDB search
MSFPLSSSSFSDKKNAFYAQSGGAAAVLNASAAGVVAGVMAHKDKIENLYIGRNGILGAL
HEDMVVVNTHDDNLIDDLLHAPAGAFGSCRYKLKSIEESEREYARILEVFKAHNIGYFFY
NGGGNSQDTSCKLAKYAAKKNYPLQCIGIPKTIDNDLSGTDCSPGYGSVAKYVAVSILEA
SMDLASMHQTSTKVFVMEVMGRDSGWIAAAAGLAADERNLGPDLIIFPEVPYEEYKFYAE
LNRIVARKGFCVVVVAEGVRGPDGNHLTSTANKDAFGHTQLGGAASIIAGRIREVTGHKT
HFAVCDYLQRAARHIASKTDVDQSFLVGKKAVEFAANGYSNVMMAIVRESEQPYRWSVGT
VPLVEAANSRNALPAGFISKCGFHITDACRRYLAPLIAGESYPSYQNGLPAYRVFNSVAV
PKKLEEFTL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccctctttctagcagttctttctcagataaaaaaaatgcattttatgcgcaa
tccggcggtgctgctgctgtactcaatgcttctgctgcaggtgttgttgctggggtaatg
gcccataaagataaaatcgaaaatctgtatattggtcgcaacggtattttgggggcattg
cacgaagatatggtggtggtgaatactcacgatgataatttaatagacgatttactccac
gcccctgcgggagcatttggctcctgtcgttacaaattaaaaagtattgaagaaagcgaa
cgtgagtacgcgcgtattctcgaggtatttaaagcacacaatattggctatttcttttat
aacggcggcggtaattcccaagacacctcttgcaagttagccaagtatgcggctaaaaaa
aattatcctctacagtgtattggtattcccaaaaccattgacaatgatttatccggcacc
gattgtagccctggctacggctcagtagctaaatacgttgccgtttcaatattagaagcg
tcgatggatttagcatctatgcatcaaacttcgactaaagtatttgttatggaagtgatg
gggcgagattctggctggattgccgcagcagcgggtttagcggcagatgagcgaaactta
gggccagatttaattatattccccgaggtgccctacgaagaatataaattctatgccgaa
ttaaatcgcattgttgcacgcaaaggtttttgcgtggtggtggtggcagaaggcgtgcga
ggcccagatggcaaccatcttacatcgaccgccaataaagatgcatttgggcacactcaa
ttaggcggtgctgcatctattattgccggtcgtatacgcgaagtaacaggccataaaaca
cattttgctgtgtgcgattacctacagcgtgctgcgcgacacatcgcctctaaaaccgat
gtggatcaatcctttttggttggcaaaaaggccgtagagtttgccgcaaatggttattcc
aatgtgatgatggcaatagtgcgagaatcagagcagccttataggtggtctgttggcact
gtgccgctggttgaggcggctaattctcgcaatgcgttacccgcaggattcatttctaaa
tgtggctttcacattacagatgcgtgtcgtcggtatttggcccctttaattgccggtgaa
agttatcctagttaccagaatgggttgcccgcttatcgagtatttaactctgtggcagtg
cctaaaaaattagaagagtttacgctttaa

DBGET integrated database retrieval system