KEGG   Saccharophagus degradans: Sde_0944Help
Entry
Sde_0944          CDS       T00335                                 

Gene name
ces8B
Definition
pectin methylesterase-like protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sde  Saccharophagus degradans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sde_0944 (ces8B)
   00500 Starch and sucrose metabolism
    Sde_0944 (ces8B)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Sde_0944 (ces8B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1224214..1225383
Genome map
AA seq 389 aa AA seqDB search
MGTKINFLLLGFILSACSLSGCADKIKRNTPLTETALPSKKILYVQTEVCDPPSQLTGSC
YNSLQRAIDVAHTVPSATHVTIEMAAGHYHERIVLSRGNIDIVGAGKNKTYVQYNLNAEQ
GKAYHRDGWGTPGSATFTINASEVNVSDLTIENTFDFLRNDSKDKTDPSKVRASQGVALL
LDEHSDKVALYRVGLYGYQDTLFANGKRAFIYQSDIAGNVDFIFGAGQVVIENSRVISRP
RGKAIASNEIAGYITAPSTNITDAFGLVFINSRLEREQGVADASVTLGRPWHPTTNFSDG
RYADPNAIGHALFFNCFMDAHIHPARWSSMKGTAKDGSKTLVFTPEQSRFFEVQSFGPSG
NDEVTTSYHSLSADSLREQALGDWNVSIN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaaaaattaattttttgctattaggttttattttgtctgcatgttcattaagt
ggctgcgccgacaaaataaagcgcaatacgcctttaaccgaaacggcattgccgagtaaa
aaaatactctatgtacaaaccgaagtatgtgacccgccttcgcaattaacgggtagttgc
tacaacagcttgcagcgagctattgacgtggcgcacacagtgccgtctgctacccatgta
accattgaaatggctgcggggcattaccacgaacgcattgtgcttagccgtggcaatatc
gatattgttggtgcaggtaaaaataaaacctatgttcaatacaacctgaatgccgagcag
ggtaaagcttatcaccgcgacggttggggtactcctggctcagctacatttaccattaat
gccagtgaagtaaatgttagcgatttaactatcgaaaatactttcgactttttaagaaat
gattcaaaagataaaaccgacccttcaaaagtgagggcatcgcaaggcgttgcattatta
ttggatgaacacagcgataaggttgcgctgtatcgagtaggcctatacggataccaagac
accctatttgcaaatggaaagcgtgcatttatctaccaatcagatattgcaggcaatgtt
gattttatttttggcgctggccaagtggttatagaaaatagtcgtgttatttctaggccg
cgcggcaaagccattgcttccaatgaaattgccggctatatcacagcgccatccaccaat
attacggacgcctttggtctggtttttattaatagtcgattagaacgtgagcaaggcgtg
gcagatgcgtcggtcaccttgggtcgcccttggcaccctacaaccaatttcagcgatggc
cgatatgccgacccaaacgcgattggccatgcgctattttttaactgctttatggatgcg
catattcaccccgcgagatggtctagcatgaaaggcaccgctaaagacggcagtaaaacg
ctagtgtttacgcccgagcaatcgcgtttttttgaagttcagtcctttggccccagcggc
aacgatgaagtaaccacctcgtatcattcgttaagcgccgactcattacgcgaacaagcg
ctcggcgattggaatgtatcaattaactaa

DBGET integrated database retrieval system