KEGG   Saccharophagus degradans: Sde_0986Help
Entry
Sde_0986          CDS       T00335                                 

Definition
4-a-glucanotransferase-like protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sde  Saccharophagus degradans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sde_0986
Enzymes [BR:sde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sde_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1258888..1261062
Genome map
AA seq 724 aa AA seqDB search
MSDLDRLFYWHGIAPDFINYKGEHIQVSLENRKNLLSTMGVDVTSDALVSRAAYDLDVAP
WESWVPPLSITPAGSGAGLGINCHPAIVDKELKWVLTEEASGELVAEGLFKPITGEEVGD
YIYGDTRYTRRVLPLPDLPPNYYSLQLELKDRIESTVVAMFPVRGMMPDWLQDQAGYHGI
IIQLYTLRSATNWGVGDFNDLKQLIRFCADQGVDTIGLNPLHALLPEIEAHCSPYSPSDR
RHINPLYISLQDVPEFASVMAAMSDAEKAKLQASIEELRERPLVDYAAVRALKLDMLERM
FMTFDAARGSENASRRQEFEQFVALHGAVLERFALFEVMKADACTFEQIVEVMDSAPNSA
LLGEALQQYAIKIRSIYYQQWLAHVQFSACQALAEQLQMPIGIIRDLAVGADRGGAEVLS
NQHLFCAKAAAGAPPDAFSAIGQNWGLPPMDPAGLRKSGFAHFRELLRSNMASCGALRID
HAMGLMRLWWCPPGKTADYGAYVYYPFEELIALLKLESHLNNCVVIGEDLGIVPHNFRET
MSAAGVVSNKVFYFERTGPTSFKPPSHYDSFALAMINNHDVPTLASWWNGQDILLRRDLD
TLGEGANLDALLDERRQEKEDLFAQLNRDGFLPNSWHDKSVHETADQNLVFSIMKWMAQV
NSKLYVIQLEDLMLMTDPVNVPGTYQEYPNWQRKLKLSVEDLEKNTAVTDLLKSISNTRK
NKGN
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttggatcgcttgttctactggcacggtattgctccagattttataaattat
aaaggggagcatattcaggtttccctagaaaaccgcaaaaatctgctctccactatgggt
gtggacgtaacctctgatgcgttggttagtcgcgcggcgtatgaccttgatgtcgcccct
tgggaatcctgggtgccccctttgtcgattacacctgccggcagcggcgccggtttgggt
ataaattgccacccagctatagtcgataaagagctaaagtgggtattaacagaagaagcg
agtggcgagttagttgcagaaggattatttaagccgattacaggggaggaggtcggcgat
tatatttacggtgatacacgttatacaagacgggtactccctcttcccgatttacctccc
aattattactctttacagctagagctgaaagataggattgaatcgactgttgttgcgatg
ttccccgtgcggggaatgatgcctgattggctgcaagatcaggccggctatcacggtatt
attatccagctttacactttgcgatccgctacaaactggggggttggcgactttaatgat
ttaaaacaattaatacgattttgcgccgatcagggcgttgatactatcggtttaaacccc
ctccacgcgctcttgccagagatagaagcgcattgcagcccatatagcccctctgacagg
cggcatataaaccctctttatatttcgctacaggatgtaccagagttcgccagtgtaatg
gcggctatgtcagatgccgagaaagccaagcttcaggccagcatcgaagaattaagagag
cggccattggttgactatgcagctgtgcgagcactgaagttggatatgcttgagcgaatg
ttcatgacttttgatgctgctcgtggctcggagaacgcatctagacggcaagagtttgaa
caatttgtggctcttcatggtgcggtgctagagcgctttgcgctttttgaagtcatgaaa
gcggatgcctgtacctttgagcaaatagtggaagtgatggatagtgcgcccaatagcgct
ctgttaggcgaagctttacagcaatatgcaatcaaaattcgcagtatctactaccagcag
tggttagctcatgttcagttttcggcgtgccaagctttggctgaacagttgcaaatgcct
atagggataatacgtgacttagccgttggggcagaccgtggcggtgctgaggtgttgagc
aaccaacatttgttttgtgctaaagctgcggcaggagcgccaccagacgccttctctgcc
attgggcagaactggggcttgccaccgatggaccccgcaggcttaaggaaaagtggcttt
gcgcactttcgcgaattattgcgcagtaatatggctagctgtggagcgttgcgtatagac
catgcaatggggttgatgcgcctgtggtggtgccctccgggcaaaaccgcagattatggc
gcttacgtttactacccctttgaagagttaatagctttgttaaagctcgaaagccattta
aacaactgtgttgttattggtgaagacctagggattgttcctcataactttagagaaaca
atgtctgcagctggtgtggtgtcgaataaagtcttttattttgagcgcactgggcctact
tcctttaagccgcccagtcactacgattcgtttgccctagcaatgataaacaatcatgac
gtgccgacgctcgcaagctggtggaacgggcaggatattctattgaggcgagatttagat
accctaggcgaaggggcgaatctcgatgcgctgctggatgagcgtcgacaagaaaaagaa
gatctatttgctcagctcaatcgagatggctttttgccaaatagttggcacgataaaagc
gtgcatgaaacagcagaccaaaatttggtcttttctattatgaagtggatggcgcaagtt
aactctaagttatatgtgattcagctggaggacttaatgttaatgaccgatccagtaaac
gtgcctggtacataccaagagtacccaaactggcagcgcaaactcaaattgtccgttgaa
gatctagaaaaaaatactgccgttaccgatttgttaaagagcattagcaatacacgaaaa
aataagggaaattaa

DBGET integrated database retrieval system