KEGG   Saccharophagus degradans: Sde_0987Help
Entry
Sde_0987          CDS       T00335                                 

Definition
putative 1,4-a-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sde  Saccharophagus degradans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1261070..1263259
Genome map
AA seq 729 aa AA seqDB search
MLSITPEIIKEIVQGEYHDVFAVLGPHAQKNGYVIRAFFPAAKTLQVKSKLDGSVLAEAV
MRNEEGFFEANCNCSEKPSYYFTVGYGDKEFDVEDMYRFGSTIPEGDLYLFGEGTYEQAY
RLFGAHPTEVDGVPGCRFTVWAPNAKTVAVVGDFNFWQGRAHVMRKHIPSGIWELFIPYL
GEGALYKYEIRNHSGDCLPHKADPYGFAAQKPPEQASVVSVLDRYEWNDAEWFAKANNWT
QRDRPISIYEVHLGSWKRVVEEDNRYLSYKELAADLIPYVKSMGFTHIQLMPISEFPFDG
SWGYQPVGLYAPTSRFGSPEDFKYFVDCCHQNDLAVLIDWVPGHFPTDSHGLGLFDGTPL
YEHADSRQGFHPDWNTYIYNYGRHEVKSFLMANALFWLEQYHIDGLRVDAVASMLYLDYS
RKDGEWLPNSYGGRENLEAIDFLRLVNERVYKRFPHAMMVAEESTAWPGVSSPTSCGGLG
FGYKWNMGWMNDSLQYISKEPIHRQYHHHDMTFSLHYAFSENFVLPLSHDEVVHGKRSLL
GRMPGDAWQQFANLRAYYAFMWTHPGKKLLFMGGEFAQGMEWNHDTSLSWHQLEIDYHSG
IQTLVKSLNRLYTDVPALYKEDCMSSGFEWVEADDRHNSIFAFLRKAKDEKPVLVVANFT
PVAREGYRVGVNQPGYYRELLNTDSELFGGSNLGNEGGVHSEEIAWHQRPQSVSINIPAL
AAVVFQLDS
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctaagcattactccagaaataataaaagaaattgttcaaggcgaatatcacgatgtt
tttgctgttctcggtcctcacgctcaaaaaaatgggtatgtaatacgtgcatttttccct
gcagctaaaacgttgcaggtaaagagtaagttagacggctcggtacttgctgaggctgta
atgcgcaatgaagagggctttttcgaggcaaattgtaattgtagtgaaaagccaagctat
tattttacggttggttatggcgacaaagaatttgatgtagaagatatgtatcgcttcggc
agtacgatacctgagggagacctatatctttttggggaggggacttacgaacaggcatac
cgcctttttggtgcgcacccaacagaggttgacggtgtgcctggttgcaggttcactgtg
tgggcgccaaatgcgaaaaccgtcgccgtggtaggtgattttaacttttggcaaggccgt
gcacatgtcatgcgcaaacatataccttcgggtatttgggaattgtttattccttacctt
ggcgagggtgcgctatacaagtacgaaattagaaatcatagtggcgattgcttgcctcac
aaggccgacccttacggtttcgcagcgcaaaagccaccagagcaggcatcggttgtatcg
gtgttagatagatacgaatggaacgatgctgaatggtttgcaaaagcaaataactggacg
caacgcgatcgtcccatttctatttacgaagtgcatttgggctcgtggaagcgcgtagtt
gaagaagacaatcgttaccttagctataaagaattagccgcagatttaattccctatgtg
aaatcaatggggttcactcatatacagctaatgccaataagcgaatttccatttgatggt
tcatggggttatcagcctgttggactttatgcgccgactagccgctttggctcgccagaa
gattttaagtacttcgtagattgctgccaccaaaatgatttagccgttttaatagattgg
gtgcctgggcacttccctacggatagccacggtttgggcttgtttgatggcacaccactg
tatgagcatgctgacagtcgacaagggtttcacccagactggaacacctacatatataac
tatgggcgccatgaagttaaatcgtttttgatggcgaacgctttgttctggttggagcag
tatcatatcgatggtcttcgtgttgatgctgtcgcctctatgctctacttagactacagt
aggaaggacggcgagtggctaccaaattcctacggtggcagagaaaacttagaagcaata
gattttttgcggctggttaacgaaagggtctataaacgttttcctcacgcaatgatggtg
gcagaagaatccacggcttggccgggcgtttctagcccaacctcttgtggtggtctaggc
tttggttacaaatggaatatgggctggatgaacgacagtttgcagtacattagcaaagag
ccgatccacaggcagtaccaccatcacgacatgacatttagtttgcactatgcctttagt
gaaaactttgttttaccgctaagccacgatgaagtggtgcacggtaagcgttcgctgctg
gggcgcatgcccggggatgcttggcagcaatttgcaaatttgcgcgcctattacgcgttt
atgtggacgcaccccggcaaaaaactgctgtttatggggggcgagtttgctcagggtatg
gaatggaaccacgacacaagcttgagttggcaccagctagaaatagattatcacagtgga
atccaaactcttgttaaatcgttaaatcgactctatacagatgtgcctgcgctctacaaa
gaagattgtatgtcgagcggatttgaatgggttgaagcggacgatagacataactccatc
tttgcttttttaaggaaggcaaaagacgaaaagccagtgttggtggtggccaactttaca
cctgtagcgagagaaggctatcgggtaggcgtgaatcaaccgggttattaccgtgaatta
ttaaacacagatagtgagttgtttggcggaagtaatttaggtaatgaaggtggggtacac
agcgaagagattgcatggcaccagcggccgcaatctgtttctattaatattcctgcatta
gcagcggtggtttttcagctggactcataa

DBGET integrated database retrieval system