KEGG   Saccharophagus degradans: Sde_1000Help
Entry
Sde_1000          CDS       T00335                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sde  Saccharophagus degradans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sde_1000
   00052 Galactose metabolism
    Sde_1000
   00500 Starch and sucrose metabolism
    Sde_1000
   00520 Amino sugar and nucleotide sugar metabolism
    Sde_1000
Enzymes [BR:sde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sde_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1282263..1283087
Genome map
AA seq 274 aa AA seqDB search
MIKKCLFPVAGYGTRFLPATKSMPKEMLPVVNKPLVQYGVEEALDAGLHEIGFVTGRGKR
AIADHFDVSYELEHQIAGTDKEKYLESIRAVISKGSFSYTRQSEMRGLGDAILSGRRLIG
DEAFGVVLSDDLCVAADEGVLAQMVRLYKQFRCSIVAVQEVPEDQISKFGVIAGDPIKDG
IYQVTNMVEKPEPKDAPSNLAIIGRYILTPDIFEIIENTPPGKNNEVQLTDALMTQAQNG
CVLAYKFKGTRFDCGSVAGFVEATNFVYENIYNK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaatgcctgtttccggttgcgggatatggaactcgatttttaccggctaca
aagtctatgcccaaagaaatgttgccagtcgttaataagccattggtgcagtatggtgtg
gaagaggcgttggatgcaggtttgcatgaaattggcttcgtaaccggtcgcggtaaacgc
gccattgctgaccattttgatgtgagctatgagctagagcaccaaattgcagggacagat
aaggaaaaatatttagaatctattcgcgcagtaatttcaaaggggtcgttttcttatacc
cgtcagtctgaaatgcgcggtttaggcgatgccattttaagcggtcgtcgtttgattggt
gatgaagcctttggtgtggttttatcggatgacctatgtgttgctgccgatgaaggtgtg
ttggcgcaaatggtgcgtttgtacaagcagtttcgttgcagcattgtggcagtacaagaa
gtgcccgaggatcaaattagcaaatttggtgttattgctggcgaccccatcaaagacggt
atttaccaagtaaccaacatggttgaaaaaccagagcctaaagatgcgccgagtaacttg
gcgattattggccgttacatccttacaccagatattttcgaaattatcgaaaacacgcct
cccggtaaaaacaacgaagtacagctaaccgatgctttgatgacgcaagcgcaaaacggc
tgcgtgttagcatacaaattcaaaggtactcgttttgattgcggcagtgttgccgggttt
gtagaagctaccaattttgtttacgagaatatttacaataaataa

DBGET integrated database retrieval system