KEGG   Saccharophagus degradans: Sde_1011Help
Entry
Sde_1011          CDS       T00335                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sde  Saccharophagus degradans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sde_1011
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sde_1011
Enzymes [BR:sde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sde_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1292448..1293569
Genome map
AA seq 373 aa AA seqDB search
MSKRQLVKQSRRWVIKIGSALLTNNGRGLDREEMAVWVKQMAALSKRGYEVVLVSSGAVA
AGMTRLGWAERPKALHELQAAAAVGQSSLIQAYEQEFQKYSIKTAQILLDHDDLSNRQRY
LNARSTLRTLTKLGVIPIVNENDTVVTDEIRFGDNDTLGALVANLIEADTLCILTDQKAM
FDSDPRQNALAKMLIERSAFDPGLDAMAGDGGALGRGGMISKVRAARLAARSGANTIVVG
GKVFDVIPRVASGEILGTLLYSESQPIAARKRWLAGNMQPRGRLTLDDGAVKVLREQGKS
LLPVGVRAVEGYFTRGELVLCEDTAGREIARGLVNYSSDETNKIKGASSSRIDSLLGYKD
YDELIHRDNLVLV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagacagttagttaagcagagtcgtcgttgggtaataaaaataggtagtgcg
ctattaaccaataacggacgtggtttagatcgcgaagaaatggctgtgtgggtaaagcag
atggctgctttatccaagcgaggctatgaggtggtgttggtgtcttccggtgcggttgcg
gcgggtatgacgcgcttggggtgggccgagcggccaaaggcgctgcacgagcttcaggct
gccgctgcggtggggcagtccagtttaattcaggcctacgagcaagagtttcaaaaatac
agcattaaaactgcgcaaatcctgttggatcacgatgatttatctaatcgtcagcgctac
cttaatgcgcgctccacgctgcgcacactcactaagttgggcgtgattcctattgttaac
gaaaacgatacggtggtaaccgacgaaattcgctttggggataacgataccttgggtgcg
ttggtggccaatcttatcgaggctgacactctgtgcattctcaccgatcaaaaagcgatg
ttcgatagcgaccccaggcaaaatgcgctggctaaaatgcttattgagcgttcggcgttc
gacccagggttggatgcgatggcgggtgatggcggtgcgcttggtcgcggcggcatgatc
agcaaggtgcgcgcggcgcgtttggctgctcgttctggggcgaatactattgttgtgggc
ggtaaggtttttgatgttattccgcgggtggcgagcggcgaaattttaggaacgttactg
tattccgagtcgcagcctattgctgcgcgcaagcgctggctggcgggtaatatgcagccc
cgagggcgtttaaccctagacgacggtgcggtgaaagtgttgcgcgagcagggtaagagt
ttattgcctgttggtgtgcgcgccgtagaagggtattttactcgcggcgagctagttttg
tgtgaagatactgctggccgcgaaattgcgcgtggcttagtgaattacagtagcgatgaa
acaaataaaattaaaggtgcttccagctcgcgtatagattcgctgcttggctacaaagat
tacgacgagcttatccatcgcgataacctggtattggtttaa

DBGET integrated database retrieval system