KEGG   Saccharophagus degradans: Sde_1018Help
Entry
Sde_1018          CDS       T00335                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sde  Saccharophagus degradans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sde_1018
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_1018
   00052 Galactose metabolism
    Sde_1018
   00500 Starch and sucrose metabolism
    Sde_1018
   00520 Amino sugar and nucleotide sugar metabolism
    Sde_1018
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sde_1018
   00524 Butirosin and neomycin biosynthesis
    Sde_1018
Enzymes [BR:sde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sde_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1301478..1302443
Genome map
AA seq 321 aa AA seqDB search
MFMYPYIVADIGGTNARFALVTGKKGNAFNLEQIQILNGSEFPRLQDAMQHYIDTLGGEK
PKAACVAIAGPIDGDNARMTNLNWEFSQAAVKAEFGFDKYDTLNDFGALAVATSSLQADN
LIEIKAGTMDPKGNKAILGPGTGLGVAGLACAGDSWLPIPSEGGHVNVAPATQLECEVIR
AAMAEHGHVSAETFISGPGLVRLYRALATVRGETPKNYEPKDITAGALDGTDDLCKETLD
LFCSFIGSLSGNLALTYGAKGGVYLAGGVLPRFIDYFKSSDFVKRFSEKGVMSHYVENIP
VNLISYEYTAFVGAAAWLDQL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgtatccctatatcgttgcagacattggcggcactaacgcgcgttttgcttta
gtaacaggcaaaaaaggtaatgcgtttaatttagagcagattcaaatattaaacggcagt
gaattcccgcgtttgcaggatgcaatgcagcattacattgatacccttggtggtgaaaaa
ccaaaggctgcttgtgtggctattgccggccccattgatggcgataatgcgcgcatgacc
aatttaaattgggagtttagccaagcggcggtgaaggcagagtttgggtttgataaatac
gatacccttaacgactttggcgcattggctgtggcaaccagcagcttgcaagccgataac
ttaatagaaattaaagccggcacaatggacccaaaaggcaacaaggccattttgggccct
ggcactggtttaggagtggcaggtttggcgtgtgcaggcgatagttggttgcctattcct
agtgaaggtggccacgtaaatgttgcgccagcaacgcagttagagtgcgaagttattcgc
gcagctatggccgaacacgggcatgtatctgcagaaacgtttatatccggcccaggcctt
gtgcgtttgtatcgtgcattggctaccgttcgcggtgaaacgccaaaaaactacgagcca
aaagatattaccgcaggtgcgctagatggcactgacgacttgtgcaaagaaacgttggat
ttattttgcagctttatcggttcgctatcaggtaatttggcactaacttacggcgcaaaa
ggcggggtgtatttagcgggtggtgtgttgccgcgcttcattgattattttaaatctagt
gattttgttaagcgcttttctgaaaagggtgtaatgagccactatgtggaaaatattccc
gttaatttaattagctacgagtacaccgcatttgttggtgcggctgcctggttggatcaa
ctttaa

DBGET integrated database retrieval system