KEGG   Saccharophagus degradans: Sde_1018Help
Entry
Sde_1018          CDS       T00335                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sde  Saccharophagus degradans
Pathway
sde00010  Glycolysis / Gluconeogenesis
sde00052  Galactose metabolism
sde00500  Starch and sucrose metabolism
sde00520  Amino sugar and nucleotide sugar metabolism
sde00521  Streptomycin biosynthesis
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
Module
sde_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_1018
   00052 Galactose metabolism
    Sde_1018
   00500 Starch and sucrose metabolism
    Sde_1018
   00520 Amino sugar and nucleotide sugar metabolism
    Sde_1018
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sde_1018
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sde_1018
Enzymes [BR:sde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sde_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_8
Motif
Other DBs
NCBI-ProteinID: ABD80280
JGI: Sde1018
UniProt: Q21LZ9
Position
1301478..1302443
Genome map
AA seq 321 aa AA seqDB search
MFMYPYIVADIGGTNARFALVTGKKGNAFNLEQIQILNGSEFPRLQDAMQHYIDTLGGEK
PKAACVAIAGPIDGDNARMTNLNWEFSQAAVKAEFGFDKYDTLNDFGALAVATSSLQADN
LIEIKAGTMDPKGNKAILGPGTGLGVAGLACAGDSWLPIPSEGGHVNVAPATQLECEVIR
AAMAEHGHVSAETFISGPGLVRLYRALATVRGETPKNYEPKDITAGALDGTDDLCKETLD
LFCSFIGSLSGNLALTYGAKGGVYLAGGVLPRFIDYFKSSDFVKRFSEKGVMSHYVENIP
VNLISYEYTAFVGAAAWLDQL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgtatccctatatcgttgcagacattggcggcactaacgcgcgttttgcttta
gtaacaggcaaaaaaggtaatgcgtttaatttagagcagattcaaatattaaacggcagt
gaattcccgcgtttgcaggatgcaatgcagcattacattgatacccttggtggtgaaaaa
ccaaaggctgcttgtgtggctattgccggccccattgatggcgataatgcgcgcatgacc
aatttaaattgggagtttagccaagcggcggtgaaggcagagtttgggtttgataaatac
gatacccttaacgactttggcgcattggctgtggcaaccagcagcttgcaagccgataac
ttaatagaaattaaagccggcacaatggacccaaaaggcaacaaggccattttgggccct
ggcactggtttaggagtggcaggtttggcgtgtgcaggcgatagttggttgcctattcct
agtgaaggtggccacgtaaatgttgcgccagcaacgcagttagagtgcgaagttattcgc
gcagctatggccgaacacgggcatgtatctgcagaaacgtttatatccggcccaggcctt
gtgcgtttgtatcgtgcattggctaccgttcgcggtgaaacgccaaaaaactacgagcca
aaagatattaccgcaggtgcgctagatggcactgacgacttgtgcaaagaaacgttggat
ttattttgcagctttatcggttcgctatcaggtaatttggcactaacttacggcgcaaaa
ggcggggtgtatttagcgggtggtgtgttgccgcgcttcattgattattttaaatctagt
gattttgttaagcgcttttctgaaaagggtgtaatgagccactatgtggaaaatattccc
gttaatttaattagctacgagtacaccgcatttgttggtgcggctgcctggttggatcaa
ctttaa

DBGET integrated database retrieval system