KEGG   Saccharophagus degradans: Sde_1067Help
Entry
Sde_1067          CDS       T00335                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sde  Saccharophagus degradans
Pathway
sde00010  Glycolysis / Gluconeogenesis
sde00620  Pyruvate metabolism
sde00640  Propanoate metabolism
sde00680  Methane metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_1067
   00620 Pyruvate metabolism
    Sde_1067
   00640 Propanoate metabolism
    Sde_1067
  Energy metabolism
   00680 Methane metabolism
    Sde_1067
Enzymes [BR:sde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sde_1067
Lipid biosynthesis proteins [BR:sde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sde_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABD80329
JGI: Sde1067
UniProt: Q21LV0
Position
1367106..1369043
Genome map
AA seq 645 aa AA seqDB search
MSTPHLYPVPEALAANAHINNEKYHTDYARSINEPDVFWAEKAREFLTWDKPWQSVRSFD
FHKGEATWFEGGKLNVTVNCIDRHLPTKANDVAIIWEGDDPSVDASITYQQLHDAVCKFA
NVLKARGVAKGDRVCIYMPMIPEAAYAMLACARIGAVHSIVFGGFSPEALKDRIVDSDCK
VLITADEGLRGGRAVALKANADKAVAHCPQVHSVIVVKRTGADVAWNTERDIWLHEAQQS
VDTVCEPESMDSEDPLFILYTSGSTGKPKGVLHTTGGYLLQAAMTHKYVFDYQPGEVYWC
TADVGWVTGHTYIVYGPLTNGATTLMFEGVPTYPTAARCWEVCDKHNVNIFYTAPTAIRA
LMGQGDEFVASTQRKSLRILGTVGEPINPEAWEWYYNVVGDRRCPIMDTWWQTETGGHML
TPLPGAIDLKPGSATLPFFGVEPVLLDGEGNIIEGEGEGSLAIKSSWPGQIRTVYGDHDR
LIQTYFSTYPGYYFTGDGARRDADGYYWITGRVDDVLNVSGHRMGTAEVESALVLHPKVA
EAAVVGYPHDVKGQGIYAYVTLMTGVEPDDGLRKELVAMCTQEIGPIAKPDLIQWAPGLP
KTRSGKIMRRILRKVAANELDTLGDTSTLADPSVVDDLIENRMNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgccccatctatacccagtgcccgaggcattggctgctaacgcacacatcaac
aacgagaaataccataccgattacgctcgctctattaacgagcccgatgttttttgggca
gaaaaagcccgcgaatttttaacctgggataaaccttggcaatctgtacgcagcttcgac
ttccacaaaggtgaagcaacgtggtttgaaggtggcaagctaaacgtaacggtaaactgt
attgatcgccatttacctacaaaagcaaacgacgttgctattatttgggaaggggacgac
ccttcggtagatgcgagtattacttatcagcaattgcacgatgcagtatgtaaatttgca
aatgtattaaaagcgcgcggcgtagctaaaggcgatagagtttgtatctatatgccgatg
attcccgaggcggcctacgccatgttggcctgtgcccgtattggtgcagtgcactctatt
gtatttggtggcttttctcccgaggcgctcaaagatcgtattgttgactccgactgtaaa
gtacttatcaccgccgatgaaggcttgcgaggcggccgtgcggttgcgttaaaagccaat
gccgacaaagctgtcgcccactgcccacaggttcattcggttattgtggttaagcgcaca
ggcgcagatgtagcgtggaacaccgagcgcgatatttggttgcacgaagcccagcagtct
gtggatacggtttgcgagccagagtctatggactctgaagacccgctgtttattttgtat
acctcgggctctacgggtaagcctaagggtgtattgcacacaaccggtggttacctctta
caagctgccatgacccacaaatacgtgttcgattaccagcctggcgaagtgtattggtgt
accgcagacgtaggttgggtaaccgggcacacctatattgtgtacggcccattaaccaat
ggtgccaccacccttatgttcgaaggggtacccacctacccaacggctgcgcgctgctgg
gaggtgtgcgataaacacaatgtaaatatcttttacaccgcccccacggccattcgcgcg
cttatgggccaaggtgatgagtttgtagcgtcaacccagcgcaagagtttacgaatattg
ggtacggtaggcgagcccattaaccctgaggcgtgggagtggtactacaacgttgtaggt
gaccgacgctgcccaattatggatacctggtggcaaacagagacgggcggccacatgctt
acgccgttgccgggtgcaattgacttaaaaccaggctcggccactttgccattttttggt
gtagagccagtactgcttgatggtgaaggcaatatcattgagggcgaaggtgaaggcagc
ttggccattaaatccagctggcctgggcaaattcgcacagtgtacggcgatcacgaccga
ttgattcaaacctacttcagtacctaccctggttattactttactggtgatggcgcgcgc
agagacgccgacggctattactggattaccggccgcgtagacgacgtgctgaacgtatct
ggccatcgcatggggacagcagaggtggaaagcgccttggtattacaccccaaagttgca
gaggcggcagtggtaggttacccgcacgatgtaaaagggcagggcatatatgcctacgta
acacttatgaccggggttgagcctgacgacggtttacgcaaagagctggttgcaatgtgc
acccaagaaatagggccaattgctaagccagaccttattcaatgggcgccagggctgcct
aaaacgcgctcaggtaagataatgcgccgtattttgcgtaaagttgccgctaacgagttg
gatacgctcggtgatacgtctacactagcagacccaagcgtagtagacgatttaatagaa
aatcgtatgaatcgctaa

DBGET integrated database retrieval system