KEGG   Saccharophagus degradans: Sde_1208Help
Entry
Sde_1208          CDS       T00335                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sde  Saccharophagus degradans
Brite
Enzymes [BR:sde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sde_1208
Secretion system [BR:sde02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sde_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1551628..1552422
Genome map
AA seq 264 aa AA seqDB search
MKTLLATALLTCATIGGSLAATSALAEKPKAAAEKNEVSAKQDIDLARKNITSALAAARP
DLVVTDVVKTPVEGIYKTTISNGPAVYSTADGQFFMAGELFRVQPGGIVNLTEQEMNGER
AKLLAGMDVKDMIVFSPKGDVKGVVSVFTDVDCGYCQKLHQEVPQLNAMGIEVRYMAFPR
MGIGSGAYNKIVSAWCAADKQDALTKLKARQSIPENLCKTNPVNEQYATGQQMGISGTPA
IVLGNGELIPGYVPADRLAARLGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattactggcaaccgcgctattaacatgcgcgacaatcggtggctcgttggca
gcgactagcgctttggctgaaaagccaaaagcagcggcagagaaaaatgaggtttcagcc
aagcaggatatcgacttagctcgcaaaaatattacttcggcacttgctgcggcacgtcca
gacttggtagtaacagatgtagttaaaaccccagtggagggtatttacaaaaccacaata
tctaacggcccagctgtgtattctactgcagatggtcagttttttatggcaggggagctt
tttcgcgtacagccaggcggcattgttaatttaaccgagcaagagatgaacggtgagcgc
gctaagttactggcgggcatggatgtaaaagatatgatcgtattttcaccgaaaggtgat
gtaaaaggtgtggtgtcggtatttaccgatgtagactgtggctattgccaaaagctacac
caagaagtgccacagcttaacgcaatgggtattgaggtgcgctatatggcgtttccacgt
atgggtatcggttctggtgcctataacaagattgtttcggcatggtgtgctgcagataag
caggatgcactaaccaagcttaaagcccgccaaagcattccagaaaacttgtgtaaaacg
aatcctgtgaatgagcagtatgctactgggcagcaaatgggtatatctggcacccctgca
attgtgctgggtaacggtgagcttatacccggttatgtacccgcagacagattggcagcg
cgtttagggctgtaa

DBGET integrated database retrieval system