KEGG   Saccharophagus degradans: Sde_1210Help
Entry
Sde_1210          CDS       T00335                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sde  Saccharophagus degradans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sde_1210
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sde_1210
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sde_1210
Enzymes [BR:sde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sde_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1554008..1555405
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGDAPALSFEDVVLTGLANDGGLYLPETLPKFSAEEIASWRGLDYRELAFKIIS
PFVDGEIPDADLKKLIESAYSKFRHDAIAPLVQTGHNEFILELFQGPTLAFKDFALQFLG
HLFDYVLKKRNQKVVVMGATSGDTGSAAIEGCRDCENIDIFILHPNKRVSDVQRRQMTTV
LTDNVHNIALEGNFDDCQNMVKASFADQSFLPDGRQLVAVNSINWARIMAQIVYYFYAGL
ALGSPARPVSFSVPTGNFGDIFAGYLAKQMGLPIDQLIIATNSNDILHRCISNNDHSKQP
LVHSISPSMDIMVSSNFERMLFDLYDRDGAAIKQLMEDFKSGEMSLAEGPLSKARELFSS
YRLDDKETVDVIREVFENTEYLLDPHTAIGVQAARKQRKSKDVPMVCLATAHPAKFPEAV
RQAGQAADPALPLHMRDLFDREERYTVLENDLAKVHAHMAANINA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatataagtacccgaggggatgccccagctctaagttttgaagacgttgtgtta
accggcttggctaacgatggcggtttatacttgcctgaaacgctacctaaatttagtgcc
gaagaaattgccagttggcgcggtttggattatcgcgagttggctttcaaaattatttcc
ccgtttgttgatggcgaaataccggatgccgatttaaaaaagctaatcgaaagtgcttac
tctaagtttcgtcacgatgcgattgcaccactagtacaaactggccataacgaatttatt
ttagagttgttccaagggccgacgttagcgtttaaagatttcgcgttgcagtttttaggg
cacttgtttgattacgtgcttaaaaagcgcaatcaaaaagttgtggttatgggggcaacc
tctggcgacaccggttcggctgctattgaagggtgtcgtgattgcgaaaatatcgacatc
tttattttgcacccaaacaagcgcgtgtccgatgtacagcgtcgtcagatgactacagtg
cttaccgataatgtgcacaacattgcattagaaggtaattttgacgattgccaaaatatg
gttaaagcgagctttgccgatcaatcgtttttacctgatggccgccagcttgtagcggta
aactctattaactgggcgcgtattatggctcagattgtttactatttttacgccggtttg
gcgttgggctcgccagctcgccctgtgtccttctctgtgccaacgggtaacttcggtgat
atttttgcaggctatttagctaagcaaatgggcttacctatcgatcagctgattattgca
actaacagtaatgatattttgcatcgctgtattagcaataacgaccacagcaaacagcct
ttggtacattcaatttcgccaagtatggatattatggtatccagcaacttcgaacgtatg
ctgtttgatttgtacgaccgcgacggtgcggcgattaaacaattgatggaagactttaag
tctggtgaaatgtctttggctgaaggcccattaagtaaggcgcgagaattgttcagcagc
tatcgtttagacgataaagaaacagttgatgtcattcgcgaagtatttgaaaacactgaa
tacttgttagaccctcacactgcaattggtgtgcaggccgcgcgtaaacagcgcaagtct
aaagatgtgcccatggtatgtcttgcaactgctcacccagctaagttccctgaagccgtg
cgtcaagcgggccaagcggctgaccctgcgttgccattgcatatgcgtgatttatttgat
cgtgaagagcgctacacagttttagagaacgatttagcaaaagtgcacgcgcatatggcg
gcaaatataaacgcttaa

DBGET integrated database retrieval system