KEGG   Saccharophagus degradans: Sde_1250Help
Entry
Sde_1250          CDS       T00335                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sde  Saccharophagus degradans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1600482..1601153
Genome map
AA seq 223 aa AA seqDB search
MDRLKLEGVGMTSKRTRDRLVERLLEQGVTSQFVLELIANTPRHLFLDEALSHRAYEDAS
LPIGFGQTLSQPYIVARMTEILLGAAGDPKRVLEIGTGSGYQTCILAQAVEHVWSVERIK
PLQDKAKQRLRHLGLNNVTYKHADGGFGWPEQGPFDAILSAAAPRDIPKSLLQQLAHNGV
LVIPVGADEQVLTLVIRDGEEDKFITQKLEPVKFVPLLSGVTR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgattaaaactagaaggcgtggggatgacctctaaacgcactcgtgaccgtttg
gtcgagcgtttgctcgagcaaggggtaactagtcagtttgtgttggagttaatagccaat
acgccacggcatttattcttagatgaagcgctttcccaccgcgcttatgaagatgcgtcc
ctccctataggcttcggccaaaccctttcccagccctacattgttgcccgaatgaccgaa
atattgctcggtgccgctggcgaccccaagcgcgtgctcgaaataggcactggctctggc
taccaaacctgcattttggcgcaagccgttgaacatgtgtggagcgtggaacgaattaag
ccattgcaggacaaagcaaaacagcgcttaaggcacctagggctaaataatgtcacctat
aagcacgcggatggcggcttcggttggcccgagcaggggcccttcgatgcaattctttct
gccgcggcacctcgcgatattcctaaaagtctgctacagcaattggcgcacaatggcgtg
ctggttatccccgtgggtgctgatgagcaggtgcttaccctagtgataagggatggcgaa
gaagacaaattcataacccaaaaattagaacctgttaagtttgtaccactactatctgga
gtaacacgttaa

DBGET integrated database retrieval system