KEGG   Saccharophagus degradans: Sde_1337Help
Entry
Sde_1337          CDS       T00335                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sde  Saccharophagus degradans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sde_1337
DNA repair and recombination proteins [BR:sde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sde_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1733089..1733682
Genome map
AA seq 197 aa AA seqDB search
MFSPLIDQLINSLRHLPGVGPKSAQRMALHLLERDREGAQNLSEVLAKAVEHVHRCQQCR
TLTEQALCNICSNARRNRKELCIVETPADVIAIETSAVFSGYYFVLLGRLSPIDGIGPKE
IGMDVLASRFAEGEIEEVIIATNPTIEGEATAHYISERAKAQGIKVSRIAHGIPIGGELE
YVDGGTLAHAISRRQEI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtccgcttatagatcaacttatcaactcgcttcgacacttgcctggcgtgggg
ccaaaatcggcacagcgcatggcgctccatttgctcgagcgcgaccgagaaggggcacaa
aacctgtcggaagttttagcgaaagcggtggagcacgtacaccgctgccagcagtgccgc
actttaacagagcaagcgctgtgtaatatttgtagcaacgcacgtcgcaatcgtaaagag
ctgtgcatagtagaaacccccgcagatgtaatcgccatagaaacatcggcggtgttctct
ggttattattttgtcttgctgggtcggttatcacctatcgacggcataggccccaaagaa
ataggtatggatgtattggcttcccgttttgccgaaggtgaaatagaagaagtgattatt
gcaaccaacccaactattgaaggcgaagcaaccgcgcactacatttcggagcgggccaaa
gcgcaaggtataaaagtgtcgcgtatcgcacacggcataccaataggtggcgaattagaa
tatgtagatggcggcaccttagcgcacgctattagtcgcagacaggagatataa

DBGET integrated database retrieval system